We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CXCR2/IL-8RB Recombinant Protein Antigen

Images

 
There are currently no images for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CXCR2/IL-8RB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CXCR2.

Source: E. coli

Amino Acid Sequence: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CXCR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38195.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CXCR2/IL-8RB Recombinant Protein Antigen

  • CD182 antigen
  • CD182
  • CDw128b
  • chemokine (C-X-C motif) receptor 2
  • chemokine (CXC) receptor 2
  • CMKAR2
  • C-X-C chemokine receptor type 2
  • CXCR2 gene for IL8 receptor type B
  • CXCR2
  • CXC-R2
  • CXCR-2
  • GRO/MGSA receptor
  • High affinity interleukin-8 receptor B
  • IL-8 RB
  • IL-8 receptor type 2
  • IL-8R B
  • IL8R2
  • IL8RA
  • IL8RB
  • interleukin 8 receptor B
  • interleukin 8 receptor type 2
  • interleukin-8 receptor type B

Background

Chemokine (Chemoattractant Cytokines) are small peptides that are potent activators and chemo-attractants for leukocyte subpopulations and other non-hemopoietic cells. Chemokine receptors (CXCR) belong to the super-family of G protein-coupled receptors (GPCR), which regulate the trafficking and activation of leukocytes, and operate as co-receptors in the entry of HIV-1 and proliferation and migration of immature neurons, glia and their precursors. Furthermore, chemokine receptors participate in the etiology and progression of various brain disorders, including AIDS dementia, neuro-inflammatory disease and neuroplasia, making them important potential therapeutic targets in these cases several subtypes of CXCR have been characterized. Activation of na

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB330
Species: Hu
Applications: CyTOF-reported, Flow, IHC, Neut
DY453
Species: Mu
Applications: ELISA
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DCP00
Species: Hu
Applications: ELISA
MM200
Species: Mu
Applications: ELISA
DY393
Species: Hu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
MAB150
Species: Hu
Applications: CyTOF-ready, Flow, IHC
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
DY443
Species: Mu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
MAB145
Species: Hu
Applications: CyTOF-ready, Flow
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-38195PEP
Species: Hu
Applications: AC

Publications for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP) (0)

There are no publications for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP) (0)

There are no reviews for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CXCR2/IL-8RB Products

Research Areas for CXCR2/IL-8RB Recombinant Protein Antigen (NBP2-38195PEP)

Find related products by research area.

Blogs on CXCR2/IL-8RB

There are no specific blogs for CXCR2/IL-8RB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CXCR2/IL-8RB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCR2