CXCR1/IL-8RA Antibody

Images

 
Immunohistochemistry-Paraffin: CXCR1/IL-8 RA Antibody [NBP2-48621] - Staining of human bone marrow shows positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXCR1/IL-8RA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXCR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXCR1/IL-8RA Recombinant Protein Antigen (NBP2-48621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXCR1/IL-8RA Antibody

  • CD128
  • CD181 antigen
  • CD181
  • CDw128aC-C
  • chemokine (C-X-C motif) receptor 1
  • CKR-1
  • CMKAR1
  • C-X-C chemokine receptor type 1
  • CXCR1
  • CXC-R1
  • CXCR-1
  • High affinity interleukin-8 receptor A
  • IL-8 RA
  • IL-8 receptor type 1
  • IL-8R A
  • IL8R1
  • IL8RA
  • IL8RAC-C-CKR-1
  • IL8RBA
  • interleukin 8 receptor, alpha
  • interleukin-8 receptor type 1
  • interleukin-8 receptor type A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
MAB331
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DCP00
Species: Hu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-35334
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB145
Species: Hu
Applications: CyTOF-ready, Flow
MME00
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
7268-CT
Species: Hu
Applications: BA
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
6507-IL/CF
Species: Hu
Applications: BA
DCC700
Species: Hu
Applications: ELISA
NBP2-48621
Species: Hu
Applications: IHC, IHC-P

Publications for CXCR1/IL-8RA Antibody (NBP2-48621) (0)

There are no publications for CXCR1/IL-8RA Antibody (NBP2-48621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCR1/IL-8RA Antibody (NBP2-48621) (0)

There are no reviews for CXCR1/IL-8RA Antibody (NBP2-48621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXCR1/IL-8RA Antibody (NBP2-48621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCR1/IL-8RA Products

Bioinformatics Tool for CXCR1/IL-8RA Antibody (NBP2-48621)

Discover related pathways, diseases and genes to CXCR1/IL-8RA Antibody (NBP2-48621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCR1/IL-8RA Antibody (NBP2-48621)

Discover more about diseases related to CXCR1/IL-8RA Antibody (NBP2-48621).
 

Pathways for CXCR1/IL-8RA Antibody (NBP2-48621)

View related products by pathway.

PTMs for CXCR1/IL-8RA Antibody (NBP2-48621)

Learn more about PTMs related to CXCR1/IL-8RA Antibody (NBP2-48621).
 

Research Areas for CXCR1/IL-8RA Antibody (NBP2-48621)

Find related products by research area.

Blogs on CXCR1/IL-8RA

There are no specific blogs for CXCR1/IL-8RA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCR1/IL-8RA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCR1