CXCL4L1 Antibody

Images

 
Western Blot: CXCL4L1 Antibody [NBP1-70510] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXCL4L1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PF4V1(platelet factor 4 variant 1) The peptide sequence was selected from the middle region of PF4V1. Peptide sequence RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PF4V1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PF4V1 and was validated on Western blot.
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CXCL4L1 Antibody

  • CXCL4V1
  • PF4A
  • PF4-ALT
  • platelet factor 4 variant 1
  • platelet factor 4 variant
  • variant 1 (PF4-like)

Background

PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

795-P4/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
H00009910-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for CXCL4L1 Antibody (NBP1-70510) (0)

There are no publications for CXCL4L1 Antibody (NBP1-70510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL4L1 Antibody (NBP1-70510) (0)

There are no reviews for CXCL4L1 Antibody (NBP1-70510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL4L1 Antibody (NBP1-70510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL4L1 Products

Bioinformatics Tool for CXCL4L1 Antibody (NBP1-70510)

Discover related pathways, diseases and genes to CXCL4L1 Antibody (NBP1-70510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL4L1 Antibody (NBP1-70510)

Discover more about diseases related to CXCL4L1 Antibody (NBP1-70510).
 

Pathways for CXCL4L1 Antibody (NBP1-70510)

View related products by pathway.

PTMs for CXCL4L1 Antibody (NBP1-70510)

Learn more about PTMs related to CXCL4L1 Antibody (NBP1-70510).

Blogs on CXCL4L1

There are no specific blogs for CXCL4L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL4L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PF4V1