CSRP1 Antibody

Images

 
Western Blot: CSRP1 Antibody [NBP2-88794] - WB Suggested Anti-CSRP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Stomach

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSRP1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CSRP1. Peptide sequence: YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%), Bovine (92%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
CSRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSRP1 Antibody

  • CRP
  • CRP1
  • CSRP1
  • CSRPCYRP
  • CYRP
  • cysteine and glycine-rich protein 1
  • Cysteine-rich protein 1
  • D1S181E
  • DKFZp686M148
  • LIM-domain protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-88794
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for CSRP1 Antibody (NBP2-88794) (0)

There are no publications for CSRP1 Antibody (NBP2-88794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP1 Antibody (NBP2-88794) (0)

There are no reviews for CSRP1 Antibody (NBP2-88794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSRP1 Antibody (NBP2-88794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CSRP1 Products

Bioinformatics Tool for CSRP1 Antibody (NBP2-88794)

Discover related pathways, diseases and genes to CSRP1 Antibody (NBP2-88794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP1 Antibody (NBP2-88794)

Discover more about diseases related to CSRP1 Antibody (NBP2-88794).
 

Pathways for CSRP1 Antibody (NBP2-88794)

View related products by pathway.

PTMs for CSRP1 Antibody (NBP2-88794)

Learn more about PTMs related to CSRP1 Antibody (NBP2-88794).

Blogs on CSRP1

There are no specific blogs for CSRP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRP1