CRTAP Antibody (4D9)

Images

 
Western Blot: CRTAP Antibody (4D9) [H00010491-M01] - CRTAP monoclonal antibody (M01), clone 4D9 Analysis of CRTAP expression in HeLa.
Immunohistochemistry-Paraffin: CRTAP Antibody (4D9) [H00010491-M01] - Analysis of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: CRTAP Antibody (4D9) [H00010491-M01] - Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRTAP Antibody (4D9) Summary

Immunogen
CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS
Specificity
CRTAP (4D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRTAP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Control
HeLa Whole Cell Lysate
Publications
Read Publications using H00010491-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRTAP Antibody (4D9)

  • cartilage associated protein
  • cartilage-associated protein
  • CASPLEPREL3
  • leprecan-like 3

Background

The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. Defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064175-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NB100-56116
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56529
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-92790
Species: Mu, Rt
Applications: WB, ICC/IF, IHC
NB600-408
Species: Hu, Mu, Rt, Po, Ba, Bv, Fe, Rb
Applications: WB, ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr
NB100-56118
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-67333
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77209
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-56114
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1002
Species: Hu
Applications: WB, PEP-ELISA, IF
NB120-10454
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, KO
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Gp, Ha, Pm, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP2-49242
Species: Hu
Applications: WB, IHC, IHC-P
H00010491-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for CRTAP Antibody (H00010491-M01)(3)

Reviews for CRTAP Antibody (H00010491-M01) (0)

There are no reviews for CRTAP Antibody (H00010491-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRTAP Antibody (H00010491-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CRTAP Products

Bioinformatics Tool for CRTAP Antibody (H00010491-M01)

Discover related pathways, diseases and genes to CRTAP Antibody (H00010491-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRTAP Antibody (H00010491-M01)

Discover more about diseases related to CRTAP Antibody (H00010491-M01).
 

Pathways for CRTAP Antibody (H00010491-M01)

View related products by pathway.

PTMs for CRTAP Antibody (H00010491-M01)

Learn more about PTMs related to CRTAP Antibody (H00010491-M01).

Blogs on CRTAP

There are no specific blogs for CRTAP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRTAP Antibody (4D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTAP
Entrez
OMIM
Uniprot