CROT Antibody

Images

 
Western Blot: CROT Antibody [NBP1-85503] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CROT Antibody [NBP1-85503] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CROT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWLEEWWLNVAYLDVRIPSQLNVNFAGPAAHFEHYWPPKEGTQLERGSITLWH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CROT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CROT Protein (NBP1-85503PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CROT Antibody

  • carnitine O-octanoyltransferase
  • COTperoxisomal carnitine O-octanoyltransferase
  • EC 2.3.1
  • EC 2.3.1.137
  • peroxisomal carnitine acyltransferase
  • peroxisomal carnitine octanoyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-62178
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-06672
Species: Hu
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-85503
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CROT Antibody (NBP1-85503) (0)

There are no publications for CROT Antibody (NBP1-85503).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CROT Antibody (NBP1-85503) (0)

There are no reviews for CROT Antibody (NBP1-85503). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CROT Antibody (NBP1-85503) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CROT Products

Bioinformatics Tool for CROT Antibody (NBP1-85503)

Discover related pathways, diseases and genes to CROT Antibody (NBP1-85503). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CROT Antibody (NBP1-85503)

Discover more about diseases related to CROT Antibody (NBP1-85503).
 

Pathways for CROT Antibody (NBP1-85503)

View related products by pathway.

PTMs for CROT Antibody (NBP1-85503)

Learn more about PTMs related to CROT Antibody (NBP1-85503).

Blogs on CROT

There are no specific blogs for CROT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CROT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CROT