CROT Antibody - BSA Free

Western Blot: CROT Antibody [NBP1-85502] - Analysis in control (vector only transfected HEK293T lysate) and CROT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CROT Antibody [NBP1-85502] - Staining in human thyroid gland and skeletal muscle tissues using anti-CROT antibody. Corresponding CROT RNA-seq data are presented for the same tissues.

Western Blot: CROT Antibody [NBP1-85502] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Western Blot: CROT Antibody [NBP1-85502] - Analysis using Anti-CROT antibody NBP1-85502 (A) shows similar pattern to independent antibody NBP1-85501 (B).

Immunohistochemistry-Paraffin: CROT Antibody [NBP1-85502] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: CROT Antibody [NBP1-85502] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CROT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRWGDKSYNLISFSNGVFGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIFIVDEKVLNDINQAKAQYLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CROT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CROT Protein (NBP1-85502PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CROT Antibody - BSA Free

• carnitine O-octanoyltransferase
• COTperoxisomal carnitine O-octanoyltransferase
• EC 2.3.1
• EC 2.3.1.137
• peroxisomal carnitine acyltransferase
• peroxisomal carnitine octanoyltransferase

Background

Carnitine octanoyltransferase (EC 2.3.1.137) is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria. See also CRAT (MIM 600184). Van der Leij et al. (2000) [PubMed 11001805] reviewed the function, structural features, and phylogenetics of human carnitine acyltransferase genes, including CROT.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CROT