CREM Antibody - BSA Free

Immunohistochemistry-Paraffin: CREM Antibody [NBP1-81760] - Analysis in human testis and fallopian tube tissues using NBP1-81760 antibody. Corresponding CREM RNA-seq data are presented for the same tissues.

Western Blot: CREM Antibody [NBP1-81760] - Analysis in human cell lines PC-3 and Caco-2 using Anti-CREM antibody. Corresponding CREM RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Western Blot: CREM Antibody [NBP1-81760] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Immunohistochemistry-Paraffin: CREM Antibody [NBP1-81760] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: CREM Antibody [NBP1-81760] - Staining of human prostate shows no nuclear positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CREM Antibody [NBP1-81760] -Staining of human fallopian tube shows no nuclear positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CREM Antibody [NBP1-81760] -Staining of human tonsil shows no nuclear positivity in non-germinal center cells as expected.

ChIP-Exo-Seq composite graph for Anti-CREM (NBP1-81760) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CREM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CREM Antibody - BSA Free (NBP1-81760) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 -1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CREM Protein (NBP1-81760PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CREM Antibody - BSA Free

• cAMP response element modulator
• cAMP responsive element modulator
• cAMP-responsive element modulator
• hCREM 2alpha-b protein
• hCREM 2beta-a protein
• hCREM-2
• ICER
• inducible cAMP early repressor ICER
• Inducible cAMP early repressor
• MGC111110
• MGC17881
• MGC41893

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CREM