CREM Antibody

Images

 
Western Blot: CREM Antibody [H00001390-D01P] - Analysis of CREM expression in HeLa.
Western Blot: CREM Antibody [H00001390-D01P] - Analysis of CREM expression in transfected 293T cell line by CREM polyclonal antibody.Lane 1: CREM transfected lysate(14.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREM Antibody Summary

Immunogen
CREM (NP_001872.3, 1 a.a. - 137 a.a.) full-length human protein. MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREM
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREM Antibody

  • cAMP response element modulator
  • cAMP responsive element modulator
  • cAMP-responsive element modulator
  • hCREM 2alpha-b protein
  • hCREM 2beta-a protein
  • hCREM-2
  • ICER
  • inducible cAMP early repressor ICER
  • Inducible cAMP early repressor
  • MGC111110
  • MGC17881
  • MGC41893

Background

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-38747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-32660
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00001390-D01P
Species: Hu
Applications: WB

Publications for CREM Antibody (H00001390-D01P) (0)

There are no publications for CREM Antibody (H00001390-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREM Antibody (H00001390-D01P) (0)

There are no reviews for CREM Antibody (H00001390-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREM Antibody (H00001390-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CREM Antibody (H00001390-D01P)

Discover related pathways, diseases and genes to CREM Antibody (H00001390-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREM Antibody (H00001390-D01P)

Discover more about diseases related to CREM Antibody (H00001390-D01P).
 

Pathways for CREM Antibody (H00001390-D01P)

View related products by pathway.

PTMs for CREM Antibody (H00001390-D01P)

Learn more about PTMs related to CREM Antibody (H00001390-D01P).

Blogs on CREM

There are no specific blogs for CREM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREM
Uniprot