Craniofacial Development Protein 1 Antibody


Immunohistochemistry-Paraffin: Craniofacial Development Protein 1 Antibody [NBP1-88680] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Craniofacial Development Protein 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE
Specificity of human Craniofacial Development Protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Craniofacial Development Protein 1 Protein (NBP1-88680PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Craniofacial Development Protein 1 Antibody

  • Bucentaur
  • CP27phosphoprotein (Bucentaur)
  • craniofacial development protein 1
  • p97
  • SWC5
  • Yeti


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Craniofacial Development Protein 1 Antibody (NBP1-88680) (0)

There are no publications for Craniofacial Development Protein 1 Antibody (NBP1-88680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Craniofacial Development Protein 1 Antibody (NBP1-88680) (0)

There are no reviews for Craniofacial Development Protein 1 Antibody (NBP1-88680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Craniofacial Development Protein 1 Antibody (NBP1-88680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Craniofacial Development Protein 1 Products

Bioinformatics Tool for Craniofacial Development Protein 1 Antibody (NBP1-88680)

Discover related pathways, diseases and genes to Craniofacial Development Protein 1 Antibody (NBP1-88680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Craniofacial Development Protein 1 Antibody (NBP1-88680)

Discover more about diseases related to Craniofacial Development Protein 1 Antibody (NBP1-88680).

Pathways for Craniofacial Development Protein 1 Antibody (NBP1-88680)

View related products by pathway.

PTMs for Craniofacial Development Protein 1 Antibody (NBP1-88680)

Learn more about PTMs related to Craniofacial Development Protein 1 Antibody (NBP1-88680).

Blogs on Craniofacial Development Protein 1

There are no specific blogs for Craniofacial Development Protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Craniofacial Development Protein 1 Antibody and receive a gift card or discount.


Gene Symbol CFDP1