Craniofacial Development Protein 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Craniofacial Development Protein 1 Antibody [NBP1-88680] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Craniofacial Development Protein 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFDP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Craniofacial Development Protein 1 Protein (NBP1-88680PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Craniofacial Development Protein 1 Antibody

  • BCNTBUCENTAUR
  • Bucentaur
  • CP27phosphoprotein (Bucentaur)
  • craniofacial development protein 1
  • p97
  • SWC5
  • Yeti

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46289
Species: Hu
Applications: WB, IHC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-82166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Craniofacial Development Protein 1 Antibody (NBP1-88680) (0)

There are no publications for Craniofacial Development Protein 1 Antibody (NBP1-88680).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Craniofacial Development Protein 1 Antibody (NBP1-88680) (0)

There are no reviews for Craniofacial Development Protein 1 Antibody (NBP1-88680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Craniofacial Development Protein 1 Antibody (NBP1-88680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Craniofacial Development Protein 1 Products

Bioinformatics Tool for Craniofacial Development Protein 1 Antibody (NBP1-88680)

Discover related pathways, diseases and genes to Craniofacial Development Protein 1 Antibody (NBP1-88680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Craniofacial Development Protein 1 Antibody (NBP1-88680)

Discover more about diseases related to Craniofacial Development Protein 1 Antibody (NBP1-88680).
 

Pathways for Craniofacial Development Protein 1 Antibody (NBP1-88680)

View related products by pathway.

PTMs for Craniofacial Development Protein 1 Antibody (NBP1-88680)

Learn more about PTMs related to Craniofacial Development Protein 1 Antibody (NBP1-88680).

Blogs on Craniofacial Development Protein 1

There are no specific blogs for Craniofacial Development Protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Craniofacial Development Protein 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFDP1