CPT1A Antibody - BSA Free

Immunohistochemistry: CPT1A Antibody [NBP3-35370] - Immunohistochemistry analysis of paraffin-embedded Human colon using CPT1A Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: CPT1A Antibody [NBP3-35370] - Western blot analysis of lysates from HeLa cells using CPT1A Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: CPT1A Antibody [NBP3-35370] - Immunofluorescence analysis of Hep G2 cells using CPT1A Rabbit pAbat a dilution of 1:50 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPT1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPT1A Antibody - BSA Free (NBP3-35370) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 520-720 of human CPT1A (NP_001867.2).
  
  Sequence:
  WDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPT1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPT1A Antibody - BSA Free

• carnitine O-palmitoyltransferase 1, liver isoform
• Carnitine O-palmitoyltransferase I, liver isoform
• carnitine palmitoyltransferase 1A (liver)
• Carnitine palmitoyltransferase 1A
• carnitine palmitoyltransferase I, liver
• CPT I
• CPT1
• CPT1A
• CPT1-L
• CPT1-LEC 2.3.1.21
• CPTI-L
• EC 2.3.1
• EC 2.3.1.21
• L-CPT1

Background

The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPT1A