CPSF6 Antibody - BSA Free

Immunoprecipitation: CPSF6 Antibody [NBP3-38219] - Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug CPSF6 antibody. Western blot was performed from the immunoprecipitate using CPSF6 antibody at a dilution of 1:1000.

Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP3-38219] - Confocal immunofluorescence analysis of U2OS cells using CPSF6 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Western Blot: CPSF6 Antibody [NBP3-38219] - Western blot analysis of various lysates using CPSF6 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunohistochemistry: CPSF6 Antibody [NBP3-38219] - Immunohistochemistry analysis of paraffin-embedded Rat testis using CPSF6 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CPSF6 Antibody [NBP3-38219] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using CPSF6 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CPSF6 Antibody [NBP3-38219] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using CPSF6 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: CPSF6 Antibody [NBP3-38219] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using CPSF6 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPSF6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPSF6 Antibody - BSA Free (NBP3-38219) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human CPSF6 (NP_008938.2).
  
  Sequence:
  MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPSF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:1000 - 1:3000
• Theoretical MW: 59 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPSF6 Antibody - BSA Free

• CFIM
• CFIm68
• CFIM68CPSF 68 kDa subunit
• CFIMcleavage and polyadenylation specific factor 6, 68kD subunit
• cleavage and polyadenylation specific factor 6, 68kDa
• Cleavage and polyadenylation specificity factor 68 kDa subunit
• cleavage and polyadenylation specificity factor subunit 6
• HPBRII-4
• HPBRII-7
• pre-mRNA cleavage factor I, 68kD subunit
• pre-mRNA cleavage factor Im (68kD)
• Pre-mRNA cleavage factor Im 68 kDa subunit
• Protein HPBRII-4/7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPSF6