Melatonin R1A/MT1/MTNR1A Antibody

Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Analysis of extracts of various cell lines, using Melatonin R1A/MT1/MTNR1A antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Mouse brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Rat brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Melatonin R1A/MT1/MTNR1A Antibody Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human Melatonin R1A/MT1/MTNR1A (NP_005949.1). YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTNR1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Melatonin R1A/MT1/MTNR1A Antibody

• Mel1a receptor
• Mel-1A-R
• Melatonin R1A
• melatonin receptor 1A
• melatonin receptor type 1A
• MelatoninR1A
• MT1
• MTNR1A

Background

Melatonin Receptor 1A encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Melatonin R1A/MT1/MTNR1A Antibody (NBP3-03633)(1)

Publication using NBP3-03633

• Ahluwalia A, Patel K, Hoa N Et al. Melatonin ameliorates aging-related impaired angiogenesis in gastric endothelial cells via local actions on mitochondria and VEGF-survivin signaling American journal of physiology. Gastrointestinal and liver physiology Oct 20 2021 [PMID: 34668398] (WB, Human)

FAQs for Melatonin R1A/MT1/MTNR1A Antibody (NBP3-03633). (Showing 1 - 1 of 1 FAQ).

1. I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.
   • At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.

Bioinformatics

• Gene Symbol: MTNR1A