Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Mouse brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - Rat brain using Melatonin R1A/MT1/MTNR1A antibody at dilution of 1:100 (40x lens).
Western Blot: Melatonin R1A/MT1/MTNR1A Antibody [NBP3-03633] - analysis of Mouse eye, using MTNR1A antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ...read more
Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free Summary
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human Melatonin R1A/MT1/MTNR1A (NP_005949.1). YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTNR1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ELISA Recommended starting concentration is 1 μg/mL
Immunohistochemistry 1:100-1:200
Immunohistochemistry-Paraffin
Western Blot 1:1000 - 1:5000
Theoretical MW
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP3-03633 in the following applications:
Alternate Names for Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free
Mel1a receptor
Mel-1A-R
Melatonin R1A
melatonin receptor 1A
melatonin receptor type 1A
MelatoninR1A
MT1
MTNR1A
Background
Melatonin Receptor 1A encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Melatonin R1A/MT1/MTNR1A Antibody (NBP3-03633) (0)
There are no reviews for Melatonin R1A/MT1/MTNR1A Antibody (NBP3-03633).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Melatonin R1A/MT1/MTNR1A Antibody (NBP3-03633). (Showing 1 - 1 of 1 FAQ).
I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.
At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Melatonin R1A/MT1/MTNR1A Antibody - Azide and BSA Free and receive a gift card or discount.