CPNE1 Antibody - BSA Free

Western Blot: CPNE1 Antibody [NBP2-57519] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: CPNE1 Antibody [NBP2-57519] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Western Blot: CPNE1 Antibody [NBP2-57519] - Analysis in human cell lines Caco-2 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPNE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPNE1 Antibody - BSA Free (NBP2-57519) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DLIGTFHTSLAQLQAVPAEFECIHPEKQQK
• Predicted Species: Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPNE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CPNE1 Recombinant Protein Antigen (NBP2-57519PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPNE1 Antibody - BSA Free

• copine ICPN1COPN1
• copine-1
• MGC1142

Background

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPNE1