CPNE1 Antibody

Images

 
Western Blot: CPNE1 Antibody [NBP2-57519] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: CPNE1 Antibody [NBP2-57519] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Orthogonal Strategies: Western Blot: CPNE1 Antibody [NBP2-57519] - Analysis in human cell lines Caco-2 and U2OS. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CPNE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DLIGTFHTSLAQLQAVPAEFECIHPEKQQK
Specificity
Specificity of human CPNE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPNE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
CPNE1 Knockout 293T Cell Lysate
Control Peptide
CPNE1 Recombinant Protein Antigen (NBP2-57519PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CPNE1 Antibody

  • copine ICPN1COPN1
  • copine-1
  • MGC1142

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30692
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92862
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-13207
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF, S-ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB110-60521
Species: Hu
Applications: WB, Flow
NBP2-15960
Species: Hu
Applications: WB, IHC, IHC-P
H00006045-M01
Species: Hu, Mu, I
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-46310
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85827
Species: Hu
Applications: IHC, IHC-P
NBP1-85939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB3648
Species: Hu
Applications: Flow, CyTOF-ready, Neut
NBP2-57519
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CPNE1 Antibody (NBP2-57519) (0)

There are no publications for CPNE1 Antibody (NBP2-57519).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE1 Antibody (NBP2-57519) (0)

There are no reviews for CPNE1 Antibody (NBP2-57519). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE1 Antibody (NBP2-57519) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CPNE1 Products

Bioinformatics Tool for CPNE1 Antibody (NBP2-57519)

Discover related pathways, diseases and genes to CPNE1 Antibody (NBP2-57519). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE1 Antibody (NBP2-57519)

Discover more about diseases related to CPNE1 Antibody (NBP2-57519).
 

Pathways for CPNE1 Antibody (NBP2-57519)

View related products by pathway.

Blogs on CPNE1

There are no specific blogs for CPNE1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE1