CPNE7 Antibody

Images

 
Immunohistochemistry-Paraffin: CPNE7 Antibody [NBP1-85827] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPNE7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FSTTFEEMQKAFEEGQAQWDCVNPKYKQKRRSYKNSGVVVLADLKFHRVYSF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPNE7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CPNE7 Protein (NBP1-85827PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPNE7 Antibody

  • copine 7
  • copine VIIMGC34192
  • copine-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85939
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54980
Species: Hu
Applications: WB, ICC/IF
NBP1-87521
Species: Hu
Applications: WB, IHC, IHC-P
H00006263-R01
Species: Hu
AF1936
Species: Hu
Applications: WB, IP
NBP1-62667
Species: Hu
Applications: WB
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92581
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1305
Species: Hu
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-85305
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-14286
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for CPNE7 Antibody (NBP1-85827) (0)

There are no publications for CPNE7 Antibody (NBP1-85827).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE7 Antibody (NBP1-85827) (0)

There are no reviews for CPNE7 Antibody (NBP1-85827). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE7 Antibody (NBP1-85827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPNE7 Products

Bioinformatics Tool for CPNE7 Antibody (NBP1-85827)

Discover related pathways, diseases and genes to CPNE7 Antibody (NBP1-85827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE7 Antibody (NBP1-85827)

Discover more about diseases related to CPNE7 Antibody (NBP1-85827).
 

Pathways for CPNE7 Antibody (NBP1-85827)

View related products by pathway.

PTMs for CPNE7 Antibody (NBP1-85827)

Learn more about PTMs related to CPNE7 Antibody (NBP1-85827).

Blogs on CPNE7

There are no specific blogs for CPNE7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE7