RBM12 Antibody - BSA Free

Western Blot: RBM12 Antibody [NBP2-13207] - Analysis using Anti-RBM12 antibody NBP2-13207 (A) shows similar pattern to independent antibody NBP2-13208 (B).

Immunocytochemistry/Immunofluorescence: RBM12 Antibody [NBP2-13207] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Staining of human tonsil shows nuclear positivity in germinal and non germinal center.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBM12 Antibody - BSA Free (NBP2-13207) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPINPDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  RBM12 Protein (NBP2-13207PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBM12 Antibody - BSA Free

• KIAA0765SWANHRIHFB2091
• RNA binding motif protein 12
• RNA-binding motif protein 12
• RNA-binding protein 12
• SH3/WW domain anchor protein in the nucleus

Background

RBM12 encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in two transcript variants. Both variants encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM12