RBM12 Antibody

Images

 
Western Blot: RBM12 Antibody [NBP2-13207] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: RBM12 Antibody [NBP2-13207] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RBM12 Antibody [NBP2-13207] - Staining of human tonsil shows nuclear positivity in germinal and non germinal center.
Western Blot: RBM12 Antibody [NBP2-13207] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPINPDDLYVSVHG MPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
RBM12 Protein (NBP2-13207PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM12 Antibody

  • KIAA0765SWANHRIHFB2091
  • RNA binding motif protein 12
  • RNA-binding motif protein 12
  • RNA-binding protein 12
  • SH3/WW domain anchor protein in the nucleus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB

Publications for RBM12 Antibody (NBP2-13207) (0)

There are no publications for RBM12 Antibody (NBP2-13207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM12 Antibody (NBP2-13207) (0)

There are no reviews for RBM12 Antibody (NBP2-13207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM12 Antibody (NBP2-13207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM12 Products

Bioinformatics Tool for RBM12 Antibody (NBP2-13207)

Discover related pathways, diseases and genes to RBM12 Antibody (NBP2-13207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM12 Antibody (NBP2-13207)

Discover more about diseases related to RBM12 Antibody (NBP2-13207).
 

Pathways for RBM12 Antibody (NBP2-13207)

View related products by pathway.

Blogs on RBM12

There are no specific blogs for RBM12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM12