![Western Blot: CPNE2 Antibody [NBP2-30692] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/CPNE2-Antibody-Western-Blot-NBP2-30692-img0001.jpg "Western Blot: CPNE2 Antibody [NBP2-30692] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CPNE2 Antibody - BSA Free (NBP2-30692) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPNE2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CPNE2 Antibody [NBP2-30692] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, cytosol & mitochondria.](http://images.novusbio.com/fullsize/CPNE2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30692-img0003.jpg "Immunocytochemistry/Immunofluorescence: CPNE2 Antibody [NBP2-30692] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, cytosol & mitochondria.")
![Immunohistochemistry-Paraffin: CPNE2 Antibody [NBP2-30692] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/CPNE2-Antibody-Immunohistochemistry-Paraffin-NBP2-30692-img0004.jpg "Immunohistochemistry-Paraffin: CPNE2 Antibody [NBP2-30692] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.")
![Neutralization Complement Component C5aR1 Antibody (347214) [Unconjugated]](https://images.novusbio.com/images2/Complement_Component_C5a_R1_MAB3648_Block_Neutralize_9166.jpg)
![Kininogen/Kininostatin/Bradykinin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Kininogen/Kininostatin/Bradykinin Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")