CPNE2 Antibody

Images

 
Western Blot: CPNE2 Antibody [NBP2-30692] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: CPNE2 Antibody [NBP2-30692] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, cytosol & mitochondria.
Immunohistochemistry-Paraffin: CPNE2 Antibody [NBP2-30692] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPNE2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPNE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CPNE2 Protein (NBP2-30692PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPNE2 Antibody

  • copine IICPN2
  • copine-2
  • COPN2
  • DKFZp686E06199
  • MGC16924

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54980
Species: Hu
Applications: WB, ICC/IF
NBP1-90660
Species: Hu
Applications: IHC, IHC-P
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-509
Species: Hu, Mu
Applications: WB, IP
AF1620
Species: Mu
Applications: WB, IHC
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1396
Species: Hu
Applications: WB
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX0520P-100
Species: Hu
Applications: Flow, IHC, IHC-Fr, IP
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CPNE2 Antibody (NBP2-30692) (0)

There are no publications for CPNE2 Antibody (NBP2-30692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE2 Antibody (NBP2-30692) (0)

There are no reviews for CPNE2 Antibody (NBP2-30692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CPNE2 Antibody (NBP2-30692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPNE2 Products

Bioinformatics Tool for CPNE2 Antibody (NBP2-30692)

Discover related pathways, diseases and genes to CPNE2 Antibody (NBP2-30692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CPNE2

There are no specific blogs for CPNE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE2
Uniprot