COX7A2L Antibody - Azide and BSA Free

Western Blot: COX7A2L Antibody [H00009167-B01P] - Analysis of COX7A2L expression in transfected 293T cell line by COX7A2L polyclonal antibody. Lane 1: COX7A2L transfected lysate(12.54 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COX7A2L Antibody - Azide and BSA Free Summary

• Immunogen: COX7A2L (AAH05251, 1 a.a. - 114 a.a.) full-length human protein. MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
• Specificity: COX7A2L - cytochrome c oxidase subunit VIIa polypeptide 2 like,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: COX7A2L
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX7A2L Antibody - Azide and BSA Free

• COX7ARcytochrome c oxidase subunit VII-related protein
• COX7a-related protein
• COX7RPmitochondrial
• cytochrome c oxidase subunit VIIa polypeptide 2 like
• Cytochrome c oxidase subunit VIIa-related protein
• estrogen receptor binding CpG island
• SIG81

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX7A2L
• Entrez:
  • 9167(Human)
• Uniprot:
  • AAH05251(Human)