COX15 Antibody

Images

 
Immunohistochemistry: COX15 Antibody [NBP1-86271] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COX15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COX15 Protein (NBP1-86271PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX15 Antibody

  • COX15 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX15 homolog, cytochrome c oxidase assembly protein (yeast)
  • cytochrome c oxidase assembly protein COX15 homolog
  • cytochrome c oxidase subunit 15
  • EC 1.4.4.2
  • EC 3.1.3.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20537
Species: Hu
Applications: WB
NBP1-77274
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-77273
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-123
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-56518
Species: Hu
Applications: WB
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-82653
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF885
Species: Hu
Applications: WB, IHC

Publications for COX15 Antibody (NBP1-86271) (0)

There are no publications for COX15 Antibody (NBP1-86271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX15 Antibody (NBP1-86271) (0)

There are no reviews for COX15 Antibody (NBP1-86271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COX15 Antibody (NBP1-86271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX15 Products

Bioinformatics Tool for COX15 Antibody (NBP1-86271)

Discover related pathways, diseases and genes to COX15 Antibody (NBP1-86271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX15 Antibody (NBP1-86271)

Discover more about diseases related to COX15 Antibody (NBP1-86271).
 

Pathways for COX15 Antibody (NBP1-86271)

View related products by pathway.

PTMs for COX15 Antibody (NBP1-86271)

Learn more about PTMs related to COX15 Antibody (NBP1-86271).

Blogs on COX15

There are no specific blogs for COX15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX15