COX10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: COX10 Antibody [NBP1-86322] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.

Immunohistochemistry-Paraffin: COX10 Antibody [NBP1-86322] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and COX10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

COX10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit COX10 Antibody - BSA Free (NBP1-86322) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COX10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  COX10 Protein (NBP1-86322PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for COX10 Antibody - BSA Free

• COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase)
• COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast)
• cytochrome c oxidase assembly protein
• cytochrome c oxidase subunit X
• EC 2.5.1.-
• heme A: farnesyltransferase
• Heme O synthase
• protoheme IX farnesyltransferase, mitochondrial

Background

Cytochrome c oxidase assembly homolog 10 (COX10), also known as protoheme IX farnesyltransferase, mitochondrial, is a member of the UbiA prenyltransferase family. This protein converts protoheme 9 (IX) and farnexyl diphosphate to heme O. COX10 is required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. Mutations to the COX10 gene have been linked to cytochrome c oxidase deficiency also known as mitochondrial complex IV deficiency (MT-D4D), Charcot-Marie-Tooth type 1A (CMT1A) duplication, and hereditary neuropathy with liability to pressure palsies (HNPP) deletion. Leigh syndrome has also been associated with defects in the COX10 gene where bilateral symmetrical necrotic lesions appear in the subcortical brain regions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX10