![Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize2/MGST2 Antibody-Western Blot-NBP1-82653-img0007.jpg "Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF |
| Specificity | Specificity of human, mouse MGST2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MGST2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82653 | Applications | Species |
|---|---|---|
| Efrat Dvash, Michal Har-Tal, Sara Barak et al. Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage. Nature Communications 2015 [PMID: 26656251] (IHC, WB, ICC/IF, Mouse) | IHC, WB, ICC/IF | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for MGST2 Antibody (NBP1-82653)Discover more about diseases related to MGST2 Antibody (NBP1-82653).
| Pathways for MGST2 Antibody (NBP1-82653)View related products by pathway.
|
PTMs for MGST2 Antibody (NBP1-82653)Learn more about PTMs related to MGST2 Antibody (NBP1-82653).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MGST2 |
![Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/MGST2-Antibody-Immunohistochemistry-Paraffin-NBP1-82653-img0002.jpg "Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Western Blot: GST Epitope Tag Antibody [NB600-326] - Analysis using the HRP conjugate of NB600-326. Detection of 1.0, 0.3, or 0.1 ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.2 ug/ml (1:5,000).](http://images.novusbio.com/fullsize2/GST-Epitope-Tag-Antibody-Western-Blot-NB600-326-img0010.jpg)
![Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).](http://images.novusbio.com/fullsize2/GST-Epitope-Tag-Antibody-Western-Blot-NB600-326-img0001.jpg)
![Western Blot: GST Epitope Tag Antibody [NB600-326] - Analysis using the Biotin conjugate of NB600-326. Detection of 0.1, 0.3, or 1.0 ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000). Detection: Streptavidin-HRP (0.1 ug/ml) and chemiluminescence with an exposure time of 60 seconds.](http://images.novusbio.com/fullsize2/GST-Epitope-Tag-Antibody-Western-Blot-NB600-326-img0008.jpg)
![Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Western-Blot-NBP1-89727-img0004.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0007.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0002.jpg)
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0004.jpg)
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0003.jpg)
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/SLCO6A1 Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0005.jpg)
![Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 12% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Western-Blot-NBP2-16756-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16756-img0006.jpg)
![Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunohistochemistry-Paraffin-NBP2-16756-img0014.jpg)
![Western Blot: LTC4S Antibody [NBP1-69315] - This Anti-LTC4S antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.](http://images.novusbio.com/fullsize2/LTC4S-Antibody-Western-Blot-NBP1-69315-img0001.jpg)
![Western Blot: LTC4S Antibody [NBP1-69315] - Antibody Titration: 1 ug/ml Positive control: HepG2.](http://images.novusbio.com/fullsize2/LTC4S Antibody-Western Blot-NBP1-69315-img0002.jpg)
![Western Blot: GSPT1 Antibody [NBP2-16754] - Sample (30 ug of whole cell lysate) A: HeLa 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/GSPT1 Antibody-Western Blot-NBP2-16754-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GSPT1 Antibody [NBP2-16754] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/GSPT1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16754-img0003.jpg)
![Immunohistochemistry-Paraffin: GSPT1 Antibody [NBP2-16754] - Immunohistochemical analysis of paraffin-embedded Breast ca, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/GSPT1 Antibody-Immunohistochemistry-Paraffin-NBP2-16754-img0002.jpg)
![Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 4/CHST4 Antibody [NBP1-91748] - Staining of human liver shows positivity in bile duct cells.](http://images.novusbio.com/fullsize2/Carbohydrate-Sulfotransferase-4-CHST4-Antibody-Immunohistochemistry-Paraffin-NBP1-91748-img0007.jpg)
![Immunohistochemistry: Carbohydrate Sulfotransferase 4/CHST4 Antibody [NBP1-91748] - Staining of human nasopharynx shows strong positivity in subsets of respiratory epithelial cells.](http://images.novusbio.com/fullsize2/Carbohydrate-Sulfotransferase-4-CHST4-Antibody-Immunohistochemistry-NBP1-91748-img0003.jpg)
![Immunohistochemistry-Paraffin: Carbohydrate Sulfotransferase 4/CHST4 Antibody [NBP1-91748] - Staining of human fallopian tube shows positivity in glandular cells.](http://images.novusbio.com/fullsize2/Carbohydrate-Sulfotransferase-4-CHST4-Antibody-Immunohistochemistry-Paraffin-NBP1-91748-img0004.jpg)
![Western Blot: MGST3 Antibody [H00004259-D01P] - Analysis of MGST3 expression in human liver.](http://images.novusbio.com/fullsize2/MGST3-Antibody-Western-Blot-H00004259-D01P-img0002.jpg)
![Western Blot: MGST3 Antibody [H00004259-D01P] - Analysis of MGST3 expression in K-562.](http://images.novusbio.com/fullsize2/MGST3-Antibody-Western-Blot-H00004259-D01P-img0001.jpg)
![Western Blot: MGST3 Antibody [H00004259-D01P] - Analysis of MGST3 expression in transfected 293T cell line by MGST3 polyclonal antibody.Lane 1: MGST3 transfected lysate(16.50 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/MGST3 Antibody-Western Blot-H00004259-D01P-img0003.jpg)
![Immunohistochemistry-Paraffin: FLAP Antibody [NB300-891] - Staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/fullsize2/FLAP-Antibody-Immunohistochemistry-Paraffin-NB300-891-img0003.jpg)
![Immunohistochemistry-Paraffin: FLAP Antibody [NB300-891] - Staining of paraffin embedded Human Lung. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/fullsize2/FLAP-Antibody-Immunohistochemistry-Paraffin-NB300-891-img0001.jpg)
![Immunohistochemistry-Paraffin: FLAP Antibody [NB300-891] - Staining of paraffin embedded Human Spleen. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/fullsize2/FLAP-Antibody-Immunohistochemistry-Paraffin-NB300-891-img0002.jpg)
![Western Blot: Leukotriene A4 Hydrolase/LTA4H Antibody (1E9) [NBP1-47829] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Leukotriene A4 hydrolasemonoclonal antibody.](http://images.novusbio.com/fullsize2/Leukotriene-A4-Hydrolase-LTA4H-Antibody-(1E9)-Western-Blot-NBP1-47829-img0022.jpg)
![Immunohistochemistry-Paraffin: Leukotriene A4 Hydrolase/LTA4H Antibody (1E9) [NBP1-47829] - Staining of paraffin-embedded prostate tissue using anti-Leukotriene A4 hydrolase mouse monoclonal antibody.](http://images.novusbio.com/fullsize2/Leukotriene-A4-Hydrolase-LTA4H-Antibody-(1E9)-Immunohistochemistry-Paraffin-NBP1-47829-img0020.jpg)
![Western Blot: Leukotriene A4 Hydrolase/LTA4H Antibody (1E9) [NBP1-47829] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Leukotriene A4 hydrolase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Leukotriene A4 hydrolase.](http://images.novusbio.com/fullsize2/Leukotriene-A4-Hydrolase-LTA4H-Antibody-(1E9)-Western-Blot-NBP1-47829-img0021.jpg)
![Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/Prostaglandin-E-Synthase-Antibody-Western-Blot-NBP1-87852-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human cell line SiHa shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Prostaglandin-E-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87852-img0010.jpg)
![Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining in human seminal vesicle and endometrium tissues using anti-PTGES antibody. Corresponding PTGES RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Prostaglandin-E-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87852-img0017.jpg)
![Western Blot: 5-Lipoxygenase Antibody [NB110-58748] - Detection of LOX5 in human peripheral leukocytes using NB110-58748 at 0.5(Lane 1) and 2.0 ug/ml (Lane 2).](http://images.novusbio.com/fullsize2/5-Lipoxygenase-Antibody-Western-Blot-NB110-58748-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NB110-58748] - 5-Lipoxygenase antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).](http://images.novusbio.com/fullsize2/5-Lipoxygenase-Antibody-Immunocytochemistry-Immunofluorescence-NB110-58748-img0005.jpg)
![Simple Western: 5-Lipoxygenase Antibody [NB110-58748] - Simple Western lane view shows a specific band for 5-Lipoxygenase in 0.5 mg/ml of Human Lung lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody](http://images.novusbio.com/fullsize2/5-Lipoxygenase-Antibody-Simple-Western-NB110-58748-img0006.jpg)
![Western Blot: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of GSTM2 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/fullsize2/GSTM2 Antibody (1E10)-Western Blot-H00002946-M03-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize2/GSTM2-Antibody-(1E10)-Immunocytochemistry-Immunofluorescence-H00002946-M03-img0002.jpg)
![Immunohistochemistry-Paraffin: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize2/GSTM2-Antibody-(1E10)-Immunohistochemistry-Paraffin-H00002946-M03-img0003.jpg)
![Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse and 3) rat using this antibody. 025 ug/ml.](http://images.novusbio.com/fullsize2/SOD1-Cu-Zn-SOD-Antibody-Western-Blot-NBP2-24915-img0004.jpg)
![Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in paraffin-embedded formalin-fixed human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.](http://images.novusbio.com/fullsize2/SOD1-Cu-Zn-SOD-Antibody-Immunohistochemistry-Paraffin-NBP2-24915-img0003.jpg)
![Western Blot: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis using NR1I2 mAb against human NR1I2 (AA: 1-142) recombinant protein. (Expected MW is 42.2 kDa)](http://images.novusbio.com/fullsize2/PXR-NR1I2-Antibody-(1D12G1)-Western-Blot-NBP2-61816-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis of Hela cells using NR1I2 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Secondary antibody from Fisher (Cat#: 35503)](http://images.novusbio.com/fullsize2/PXR-NR1I2-Antibody-(1D12G1)-Immunocytochemistry-Immunofluorescence-NBP2-61816-img0003.jpg)
![Western Blot: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis using NR1I2 mAb against HEK293 (1) and NR1I2 (AA: 1-142)-hIgGFc transfected HEK293 (2) cell lysate.](http://images.novusbio.com/fullsize2/PXR-NR1I2 Antibody (1D12G1)-Western Blot-NBP2-61816-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")