MGST2 Antibody

Images

 
Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MGST2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MGST2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGST2 Protein (NBP1-82653PEP)
Publications
Read Publication using
NBP1-82653 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26656251).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MGST2 Antibody

  • EC 2.5.1.18
  • FLJ27438
  • GST2MGC14097
  • MGST-II
  • microsomal glutathione S-transferase 2
  • Microsomal GST-2
  • Microsomal GST-II
  • truncated microsomal glutathione S-transferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69315
Species: Hu
Applications: WB
NBP2-47442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5357
Species: Hu
Applications: WB, IP, Neut
H00004259-D01P
Species: Hu
Applications: WB
NB300-891
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-82653
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for MGST2 Antibody (NBP1-82653)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MGST2 Antibody (NBP1-82653) (0)

There are no reviews for MGST2 Antibody (NBP1-82653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGST2 Antibody (NBP1-82653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MGST2 Products

Bioinformatics Tool for MGST2 Antibody (NBP1-82653)

Discover related pathways, diseases and genes to MGST2 Antibody (NBP1-82653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGST2 Antibody (NBP1-82653)

Discover more about diseases related to MGST2 Antibody (NBP1-82653).
 

Pathways for MGST2 Antibody (NBP1-82653)

View related products by pathway.

PTMs for MGST2 Antibody (NBP1-82653)

Learn more about PTMs related to MGST2 Antibody (NBP1-82653).

Blogs on MGST2

There are no specific blogs for MGST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGST2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MGST2