![Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize2/MGST2 Antibody-Western Blot-NBP1-82653-img0007.jpg "Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF |
| Specificity | Specificity of human MGST2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MGST2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC, WB, ICC/IF reported in scientific literature (PMID: 26656251). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82653 | Applications | Species |
|---|---|---|
| Efrat Dvash, Michal Har-Tal, Sara Barak et al. Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage. Nature Communications 2015 [PMID: 26656251] (IHC, WB, ICC/IF, Mouse) | IHC, WB, ICC/IF | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for MGST2 Antibody (NBP1-82653)Discover more about diseases related to MGST2 Antibody (NBP1-82653).
| Pathways for MGST2 Antibody (NBP1-82653)View related products by pathway.
|
PTMs for MGST2 Antibody (NBP1-82653)Learn more about PTMs related to MGST2 Antibody (NBP1-82653).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MGST2 |
![Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/MGST2-Antibody-Immunohistochemistry-Paraffin-NBP1-82653-img0002.jpg "Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).](http://images.novusbio.com/images2/GST-Epitope-Tag-Antibody-Western-Blot-NB600-326-img0001.jpg)
![Simple Western: GST Epitope Tag Antibody [NB600-326] - Simple Western lane view shows a specific band for GST Epitope Tag in 5 ng/ml of hUbiquitn-GST (left) & hISG15-GST (right) lysate(s). This experiment was performed under reducing conditions using the 12 - 230 kDa separation system.](http://images.novusbio.com/images2/GST-Epitope-Tag-Antibody-Simple-Western-NB600-326-img0004.jpg)
![Simple Western: GST Epitope Tag Antibody [NB600-326] - Electropherogram image(s) of corresponding Simple Western lane view. GST Epitope Tag antibody was used at 1:2000 dilution on hUbiquitn-GST (left) & hISG15-GST (right) lysate(s).](http://images.novusbio.com/images2/GST-Epitope-Tag-Antibody-Simple-Western-NB600-326-img0005.jpg)
![Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate](http://images.novusbio.com/images2/Glutathione-S-Transferase-kappa-1-Antibody-(JE47-38)-Western-Blot-NBP2-80461-img0001.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/Glutathione-S-Transferase-kappa-1-Antibody-(JE47-38)-Immunohistochemistry-Paraffin-NBP2-80461-img0005.jpg)
![Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).](http://images.novusbio.com/images2/Glutathione-S-Transferase-kappa-1-Antibody-(JE47-38)-Flow-Cytometry-NBP2-80461-img0006.jpg)
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.](http://images.novusbio.com/images2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0004.jpg)
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/images2/SLCO6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0003.jpg)
![Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/SLCO6A1 Antibody-Immunohistochemistry-Paraffin-NBP2-49118-img0005.jpg)
![Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Western-Blot-NBP2-16756-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16756-img0006.jpg)
![Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunohistochemistry-Paraffin-NBP2-16756-img0014.jpg)
![Western Blot: LTC4S Antibody [NBP1-69315] - This Anti-LTC4S antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.](http://images.novusbio.com/images2/LTC4S-Antibody-Western-Blot-NBP1-69315-img0001.jpg)
![Western Blot: LTC4S Antibody [NBP1-69315] - Antibody Titration: 1 ug/ml Positive control: HepG2.](http://images.novusbio.com/images2/LTC4S Antibody-Western Blot-NBP1-69315-img0002.jpg)
![Western Blot: GSPT1 Antibody [NBP2-16754] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with GSPT1 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/GSPT1-Antibody-Western-Blot-NBP2-16754-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: GSPT1 Antibody [NBP2-16754] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSPT protein stained by GSPT1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/GSPT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16754-img0005.jpg)
![Immunohistochemistry-Paraffin: GSPT1 Antibody [NBP2-16754] - Human breast cancer, using GSPT1 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min](http://images.novusbio.com/images2/GSPT1 Antibody-Immunohistochemistry-Paraffin-NBP2-16754-img0002.jpg)
![Western Blot: MGST3 Antibody (JB40-79) [NBP2-75573] - Analysis of GST3 on mouse liver tissue (1) and A549 cell (2) lysate using anti-GST3 antibody at 1/500 dilution.](http://images.novusbio.com/images2/MGST3 Antibody (JB40-79)-Western Blot-NBP2-75573-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: MGST3 Antibody (JB40-79) [NBP2-75573] - Staining GST3 in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/MGST3-Antibody-(JB40-79)-Immunocytochemistry-Immunofluorescence-NBP2-75573-img0003.jpg)
![Immunohistochemistry-Paraffin: MGST3 Antibody (JB40-79) [NBP2-75573] - Analysis of paraffin-embedded rat epididymis tissue using anti-GST3 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/MGST3-Antibody-(JB40-79)-Immunohistochemistry-Paraffin-NBP2-75573-img0007.jpg)
![Western Blot: Microsomal Glutathione S-transferase 1 Antibody (14H2) [NBP2-80410] - Analysis of Microsomal Glutathione S-transferase 1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (NBP2-80410, 1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Mouse IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: SiHa cell lysateLane 2: HepG2 cell lysateLane 3: A549 cell lysateLane 4: U937 cell lysate](http://images.novusbio.com/images2/Microsomal Glutathione S-transferase 1 Antibody (14H2)-Western Blot-NBP2-80410-img0007.jpg)
![Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody (14H2) [NBP2-80410] - Analysis in mouse liver tissue using Microsomal Glutathione S-transferase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at](http://images.novusbio.com/images2/Microsomal-Glutathione-S-transferase-1-Antibody-(14H2)-Immunohistochemistry-Paraffin-NBP2-80410-img0006.jpg)
![Flow Cytometry: Microsomal Glutathione S-transferase 1 Antibody (14H2) [NBP2-80410] - Analysis of Microsomal Glutathione S-transferase 1 was done on MCF-7 cells. The cells were fixed, permeabilized and stained with the primary antibody (1/50) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated Goat anti-Mouse IgG Secondary antibody at 1/1000 dilution for 30 minutes. Unlabeled sample was used as a control (cells without incubation with primary antibody; black).](http://images.novusbio.com/images2/Microsomal-Glutathione-S-transferase-1-Antibody-(14H2)-Flow-Cytometry-NBP2-80410-img0001.jpg)
![Immunohistochemistry-Paraffin: FLAP Antibody [NB300-891] - Staining of Human Tonsil. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/FLAP-Antibody-Immunohistochemistry-Paraffin-NB300-891-img0003.jpg)
![Immunohistochemistry-Paraffin: FLAP Antibody [NB300-891] - Staining of Human Lung. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/FLAP-Antibody-Immunohistochemistry-Paraffin-NB300-891-img0001.jpg)
![Immunohistochemistry-Paraffin: FLAP Antibody [NB300-891] - Staining of Human Spleen. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/FLAP-Antibody-Immunohistochemistry-Paraffin-NB300-891-img0002.jpg)
![Western Blot: Leukotriene A4 Hydrolase/LTA4H Antibody (OTI1E9) [NBP1-47829] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Leukotriene A4 hydrolasemonoclonal antibody.](http://images.novusbio.com/images2/Leukotriene-A4-Hydrolase-LTA4H-Antibody-(OTI1E9)-Western-Blot-NBP1-47829-img0022.jpg)
![Immunohistochemistry-Paraffin: Leukotriene A4 Hydrolase/LTA4H Antibody (OTI1E9) [NBP1-47829] - Staining of paraffin-embedded prostate tissue using anti-Leukotriene A4 hydrolase mouse monoclonal antibody.](http://images.novusbio.com/images2/Leukotriene-A4-Hydrolase-LTA4H-Antibody-(OTI1E9)-Immunohistochemistry-Paraffin-NBP1-47829-img0020.jpg)
![Western Blot: Leukotriene A4 Hydrolase/LTA4H Antibody (OTI1E9) [NBP1-47829] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Leukotriene A4 hydrolase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Leukotriene A4 hydrolase.](http://images.novusbio.com/images2/Leukotriene-A4-Hydrolase-LTA4H-Antibody-(OTI1E9)-Western-Blot-NBP1-47829-img0021.jpg)
![Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/Prostaglandin-E-Synthase-Antibody-Western-Blot-NBP1-87852-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human cell line SiHa shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/images2/Prostaglandin-E-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87852-img0010.jpg)
![Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/images2/Prostaglandin-E-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87852-img0024.jpg)
![Lymphotoxin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Lymphotoxin [Unconjugated]")
![Western Blot: 5-Lipoxygenase Antibody [NB110-58748] - Detection of LOX5 in human peripheral leukocytes using NB110-58748 at 0.5(Lane 1) and 2.0 ug/ml (Lane 2).](http://images.novusbio.com/images2/5-Lipoxygenase-Antibody-Western-Blot-NB110-58748-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: 5-Lipoxygenase Antibody [NB110-58748] - 5-Lipoxygenase antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).](http://images.novusbio.com/images2/5-Lipoxygenase-Antibody-Immunocytochemistry-Immunofluorescence-NB110-58748-img0005.jpg)
![Simple Western: 5-Lipoxygenase Antibody [NB110-58748] - Simple Western lane view shows a specific band for 5-Lipoxygenase in 0.5 mg/ml of Human Lung lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody](http://images.novusbio.com/images2/5-Lipoxygenase-Antibody-Simple-Western-NB110-58748-img0006.jpg)
![Western Blot: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of GSTM2 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/images2/GSTM2-Antibody-(1E10)-Western-Blot-H00002946-M03-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/GSTM2-Antibody-(1E10)-Immunocytochemistry-Immunofluorescence-H00002946-M03-img0002.jpg)
![Immunohistochemistry-Paraffin: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/GSTM2-Antibody-(1E10)-Immunohistochemistry-Paraffin-H00002946-M03-img0003.jpg)
![Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.](http://images.novusbio.com/images2/SOD1-Cu-Zn-SOD-Antibody-Western-Blot-NBP2-24915-img0006.jpg)
![Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.](http://images.novusbio.com/images2/SOD1-Cu-Zn-SOD-Antibody-Immunohistochemistry-Paraffin-NBP2-24915-img0003.jpg)
![Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.](http://images.novusbio.com/images2/SOD1-Cu-Zn-SOD-Antibody-Western-Blot-NBP2-24915-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")