MGST2 Antibody - BSA Free

Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.

Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MGST2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MGST2 Antibody - BSA Free (NBP1-82653) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MGST2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MGST2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MGST2 Protein (NBP1-82653PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MGST2 Antibody - BSA Free

• EC 2.5.1.18
• FLJ27438
• GST2MGC14097
• MGST-II
• microsomal glutathione S-transferase 2
• Microsomal GST-2
• Microsomal GST-II
• truncated microsomal glutathione S-transferase 2

Background

Characterized as important mediators of inflammation, MGST2 (microsomal glutathione S-transferase 2) is an important regulator of leukotriene and glutathione. MGST2 belongs to the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family of six human proteins. Several of these proteins are involved in the creation of leukotrienes and prostaglandin E. MGST2 catalyzes the production of LTC4 from LTA4 and reduced glutathione, and also catalyzes the conjugation of 1-chloro-2, 4-dinitrobenzene with reduced glutathione. Diseases associated with this gene include psoriasis, asthma, leukemia, prostatitis, breast cancer and progressive familial intrahepatic cholestasis type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MGST2 Antibody (NBP1-82653)(1)

Publication using NBP1-82653

• Efrat Dvash, Michal Har-Tal, Sara Barak et al. Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage. Nature Communications 2015-01-01 [PMID: 26656251] (WB, IF/IHC, ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: MGST2