MGST2 Antibody


Western Blot: MGST2 Antibody [NBP1-82653] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-82653] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MGST2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
Specificity of human, mouse MGST2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MGST2 Protein (NBP1-82653PEP)
Read Publication using
NBP1-82653 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26656251).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MGST2 Antibody

  • EC
  • FLJ27438
  • GST2MGC14097
  • microsomal glutathione S-transferase 2
  • Microsomal GST-2
  • Microsomal GST-II
  • truncated microsomal glutathione S-transferase 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for MGST2 Antibody (NBP1-82653)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MGST2 Antibody (NBP1-82653) (0)

There are no reviews for MGST2 Antibody (NBP1-82653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGST2 Antibody (NBP1-82653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MGST2 Products

Bioinformatics Tool for MGST2 Antibody (NBP1-82653)

Discover related pathways, diseases and genes to MGST2 Antibody (NBP1-82653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGST2 Antibody (NBP1-82653)

Discover more about diseases related to MGST2 Antibody (NBP1-82653).

Pathways for MGST2 Antibody (NBP1-82653)

View related products by pathway.

PTMs for MGST2 Antibody (NBP1-82653)

Learn more about PTMs related to MGST2 Antibody (NBP1-82653).

Blogs on MGST2

There are no specific blogs for MGST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MGST2 Antibody and receive a gift card or discount.


Gene Symbol MGST2