SCO1 Antibody - BSA Free

Western Blot: SCO1 Antibody [NBP1-87073] - Analysis using Anti-SCO1 antibody NBP1-87073 (A) shows similar pattern to independent antibody NBP1-87074 (B).

Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human cerebral cortex, colon, kidney and liver using Anti-SCO1 antibody NBP1-87073 (A) shows similar protein distribution across tissues to independent antibody NBP1-87074 (B).

Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human kidney.

Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human liver.

Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human colon.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCO1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCO1 Antibody - BSA Free (NBP1-87073) is a polyclonal antibody validated for use in IHC and WB. Anti-SCO1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 23878239). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCO1 Protein (NBP1-87073PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SCO1 Antibody - BSA Free

• protein SCO1 homolog, mitochondrial
• SCO cytochrome oxidase deficient homolog 1 (yeast)
• SCOD1SCO (cytochrome oxidase deficient, yeast) homolog 1

Background

Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog to the yeast SCO1 gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SCO1 Antibody (NBP1-87073)(1)

Publication using NBP1-87073

• Rolland SG, Motori E, Memar N et al. Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion. Proc Natl Acad Sci U S A. 2013-08-06 [PMID: 23878239] (WB, Human)

Bioinformatics

• Gene Symbol: SCO1