COUP-TF I/NR2F1 Antibody

Images

 
Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-52831] - Titration: 2 ug/ml Positive Control: Protein extracts, Chicken brain tissue.
Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-52831] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Summary
Reactivity Hu, ChSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COUP-TF I/NR2F1 Antibody Summary

Immunogen
Synthetic peptides corresponding to NR2F1(nuclear receptor subfamily 2, group F, member 1) The peptide sequence was selected from the C terminal of NR2F1. Peptide sequence VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR2F1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NR2F1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COUP-TF I/NR2F1 Antibody

  • COUP transcription factor 1
  • COUPTF I
  • COUP-TF I
  • COUP-TF1
  • COUP-TFI
  • EAR-3COUP transcription factor I
  • EAR3COUP-TF I
  • ERBAL3
  • ERBAL3V-erbA-related protein 3
  • NR2F1
  • Nuclear receptor subfamily 2 group F member 1
  • nuclear receptor subfamily 2, group F, member 1
  • SVP44
  • TCFCOUP1
  • TFCOUP1NR2F2
  • transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-ahomolog-like 3)

Background

Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-24510
Species: Hu, Ca, Pm
Applications: WB
AF4186
Species: Hu
Applications: WB, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52831
Species: Hu, Ch
Applications: WB

Publications for COUP-TF I/NR2F1 Antibody (NBP1-52831) (0)

There are no publications for COUP-TF I/NR2F1 Antibody (NBP1-52831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COUP-TF I/NR2F1 Antibody (NBP1-52831) (0)

There are no reviews for COUP-TF I/NR2F1 Antibody (NBP1-52831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COUP-TF I/NR2F1 Antibody (NBP1-52831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COUP-TF I/NR2F1 Products

Bioinformatics Tool for COUP-TF I/NR2F1 Antibody (NBP1-52831)

Discover related pathways, diseases and genes to COUP-TF I/NR2F1 Antibody (NBP1-52831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COUP-TF I/NR2F1 Antibody (NBP1-52831)

Discover more about diseases related to COUP-TF I/NR2F1 Antibody (NBP1-52831).
 

Pathways for COUP-TF I/NR2F1 Antibody (NBP1-52831)

View related products by pathway.

PTMs for COUP-TF I/NR2F1 Antibody (NBP1-52831)

Learn more about PTMs related to COUP-TF I/NR2F1 Antibody (NBP1-52831).

Blogs on COUP-TF I/NR2F1

There are no specific blogs for COUP-TF I/NR2F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COUP-TF I/NR2F1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2F1
Entrez
Uniprot