COUP-TF I/NR2F1 Antibody


Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-52831] - Titration: 2 ug/ml Positive Control: Protein extracts, Chicken brain tissue.
Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-52831] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Reactivity Hu, ChSpecies Glossary
Applications WB

Order Details

COUP-TF I/NR2F1 Antibody Summary

Synthetic peptides corresponding to NR2F1(nuclear receptor subfamily 2, group F, member 1) The peptide sequence was selected from the C terminal of NR2F1. Peptide sequence VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NR2F1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COUP-TF I/NR2F1 Antibody

  • COUP transcription factor 1
  • COUP-TF1
  • EAR-3COUP transcription factor I
  • ERBAL3
  • ERBAL3V-erbA-related protein 3
  • NR2F1
  • Nuclear receptor subfamily 2 group F member 1
  • nuclear receptor subfamily 2, group F, member 1
  • SVP44
  • transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-ahomolog-like 3)


Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Ca, Pm
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Ch
Applications: WB

Publications for COUP-TF I/NR2F1 Antibody (NBP1-52831) (0)

There are no publications for COUP-TF I/NR2F1 Antibody (NBP1-52831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COUP-TF I/NR2F1 Antibody (NBP1-52831) (0)

There are no reviews for COUP-TF I/NR2F1 Antibody (NBP1-52831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COUP-TF I/NR2F1 Antibody (NBP1-52831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COUP-TF I/NR2F1 Products

Bioinformatics Tool for COUP-TF I/NR2F1 Antibody (NBP1-52831)

Discover related pathways, diseases and genes to COUP-TF I/NR2F1 Antibody (NBP1-52831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COUP-TF I/NR2F1 Antibody (NBP1-52831)

Discover more about diseases related to COUP-TF I/NR2F1 Antibody (NBP1-52831).

Pathways for COUP-TF I/NR2F1 Antibody (NBP1-52831)

View related products by pathway.

PTMs for COUP-TF I/NR2F1 Antibody (NBP1-52831)

Learn more about PTMs related to COUP-TF I/NR2F1 Antibody (NBP1-52831).

Blogs on COUP-TF I/NR2F1

There are no specific blogs for COUP-TF I/NR2F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COUP-TF I/NR2F1 Antibody and receive a gift card or discount.


Gene Symbol NR2F1