APOBEC2 Antibody

Images

 
Immunohistochemistry: APOBEC2 Antibody [NBP1-88848] - Staining of human skeletal muscle shows cytoplasmic immunoreactivity as well as a few positive nuclei in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOBEC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APOBEC2 Protein (NBP1-88848PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOBEC2 Antibody

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
  • ARCD1
  • ARP1
  • EC 3.5.4
  • EC 3.5.4.-
  • probable C->U-editing enzyme APOBEC-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP1-57516
Species: Hu
Applications: WB
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06977
Species: Mu
Applications: WB, PEP-ELISA
AF5414
Species: Hu
Applications: WB, Simple Western
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
H00057180-B01P
Species: Hu
Applications: WB, ELISA
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
MAB4675
Species: Mu
Applications: WB, IHC, Neut
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP

Publications for APOBEC2 Antibody (NBP1-88848) (0)

There are no publications for APOBEC2 Antibody (NBP1-88848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC2 Antibody (NBP1-88848) (0)

There are no reviews for APOBEC2 Antibody (NBP1-88848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APOBEC2 Antibody (NBP1-88848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOBEC2 Products

Bioinformatics Tool for APOBEC2 Antibody (NBP1-88848)

Discover related pathways, diseases and genes to APOBEC2 Antibody (NBP1-88848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC2 Antibody (NBP1-88848)

Discover more about diseases related to APOBEC2 Antibody (NBP1-88848).
 

Pathways for APOBEC2 Antibody (NBP1-88848)

View related products by pathway.

PTMs for APOBEC2 Antibody (NBP1-88848)

Learn more about PTMs related to APOBEC2 Antibody (NBP1-88848).

Blogs on APOBEC2

There are no specific blogs for APOBEC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOBEC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC2