CORO1B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CORO1B Antibody [NBP2-55203] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CORO1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CORO1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CORO1B Recombinant Protein Antigen (NBP2-55203PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CORO1B Antibody - BSA Free

• coronin, actin binding protein, 1B
• coronin, actin-binding protein, 1B
• coronin-1B
• coronin-2
• DKFZp762I166

Background

Coronin 2 is an F-actin binding protein that plays an important role in processes involving actin dynamics such as fibroblast migration, and phagocytosis. Coronin 2 influences actin dynamics by promoting actin depolymerization. It has been shown to interact with the Arp2/3 complex and inhibit Arp2/3-induced actin nucleation. Additionally, it can regulate motility by regulating the actin severing and disassembling activity of cofilin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CORO1B