CORO1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CORO1B Antibody [NBP2-55203] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CORO1B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAAGATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGD
Specificity
Specificity of human CORO1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CORO1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CORO1B Antibody

  • coronin, actin binding protein, 1B
  • coronin, actin-binding protein, 1B
  • coronin-1B
  • coronin-2
  • DKFZp762I166

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58867
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-92304
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15968
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP1-89102
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2987
Species: Hu
Applications: WB, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NBP1-86815
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS1522
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1444
Species: Mu
Applications: WB, IHC
NBP2-65721
Species: Hu
NB110-89474
Species: Hu, Mu, Rt, Bv, ChHa
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Single Cell Western
NBP1-57418
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh, Ze
Applications: WB, IHC, IHC-P

Publications for CORO1B Antibody (NBP2-55203) (0)

There are no publications for CORO1B Antibody (NBP2-55203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CORO1B Antibody (NBP2-55203) (0)

There are no reviews for CORO1B Antibody (NBP2-55203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CORO1B Antibody (NBP2-55203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CORO1B Products

Bioinformatics Tool for CORO1B Antibody (NBP2-55203)

Discover related pathways, diseases and genes to CORO1B Antibody (NBP2-55203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CORO1B Antibody (NBP2-55203)

Discover more about diseases related to CORO1B Antibody (NBP2-55203).
 

Pathways for CORO1B Antibody (NBP2-55203)

View related products by pathway.

PTMs for CORO1B Antibody (NBP2-55203)

Learn more about PTMs related to CORO1B Antibody (NBP2-55203).

Blogs on CORO1B

There are no specific blogs for CORO1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CORO1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CORO1B