CPNE1 Antibody (8B8)

Images

 
Western Blot: CPNE1 Antibody (8B8) [H00008904-M01] - CPNE1 monoclonal antibody (M01), clone 8B8 Analysis of CPNE1 expression in HeLa.
Western Blot: CPNE1 Antibody (8B8) [H00008904-M01] - Analysis of CPNE1 over-expressed 293 cell line, cotransfected with CPNE1 Validated Chimera RNAi ( Cat # H00008904-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: CPNE1 Antibody (8B8) [H00008904-M01] - Analysis of CPNE1 expression in transfected 293T cell line by CPNE1 monoclonal antibody (M01), clone 8B8.Lane 1: CPNE1 transfected lysate(59.1 KDa).Lane 2: ...read more
Sandwich ELISA: CPNE1 Antibody (8B8) [H00008904-M01] - Detection limit for recombinant GST tagged CPNE1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
8B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CPNE1 Antibody (8B8) Summary

Immunogen
CPNE1 (NP_003906 111 a.a. - 210 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Specificity
CPNE1 - copine I
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPNE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPNE1 Antibody (8B8)

  • copine ICPN1COPN1
  • copine-1
  • MGC1142

Background

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30692
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56518
Species: Hu
Applications: WB
NBP2-13207
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB110-60521
Species: Hu
Applications: WB, Flow
NBP1-87521
Species: Hu
Applications: WB, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF1396
Species: Hu
Applications: WB
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85827
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP1-85939
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
H00008904-M01
Species: Hu
Applications: WB, ELISA, RNAi

Publications for CPNE1 Antibody (H00008904-M01) (0)

There are no publications for CPNE1 Antibody (H00008904-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE1 Antibody (H00008904-M01) (0)

There are no reviews for CPNE1 Antibody (H00008904-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE1 Antibody (H00008904-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPNE1 Products

Bioinformatics Tool for CPNE1 Antibody (H00008904-M01)

Discover related pathways, diseases and genes to CPNE1 Antibody (H00008904-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE1 Antibody (H00008904-M01)

Discover more about diseases related to CPNE1 Antibody (H00008904-M01).
 

Pathways for CPNE1 Antibody (H00008904-M01)

View related products by pathway.

Blogs on CPNE1

There are no specific blogs for CPNE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE1 Antibody (8B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE1
Entrez
OMIM
Uniprot