CPNE1 Antibody (8B8)

Images

 
Western Blot: CPNE1 Antibody (8B8) [H00008904-M01] - CPNE1 monoclonal antibody (M01), clone 8B8 Analysis of CPNE1 expression in HeLa.
Western Blot: CPNE1 Antibody (8B8) [H00008904-M01] - Analysis of CPNE1 over-expressed 293 cell line, cotransfected with CPNE1 Validated Chimera RNAi ( Cat # H00008904-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: CPNE1 Antibody (8B8) [H00008904-M01] - Analysis of CPNE1 expression in transfected 293T cell line by CPNE1 monoclonal antibody (M01), clone 8B8.Lane 1: CPNE1 transfected lysate(59.1 KDa).Lane 2: ...read more
Sandwich ELISA: CPNE1 Antibody (8B8) [H00008904-M01] - Detection limit for recombinant GST tagged CPNE1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KD
Clone
8B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CPNE1 Antibody (8B8) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
CPNE1 (NP_003906, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Specificity
CPNE1 - copine I
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPNE1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPNE1 Antibody (8B8)

  • copine ICPN1COPN1
  • copine-1
  • MGC1142

Background

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPNE1 Antibody (H00008904-M01) (0)

There are no publications for CPNE1 Antibody (H00008904-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE1 Antibody (H00008904-M01) (0)

There are no reviews for CPNE1 Antibody (H00008904-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE1 Antibody (H00008904-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE1 Antibody (8B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE1
Entrez
OMIM
Uniprot