p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

Western Blot: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Western blot analysis of extracts of Mouse brain, using p70 S6 Kinase beta/S6K2 Rabbit mAb (NBP3-16752) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Confocal imaging of C2C12 cells using p70 S6 Kinase beta/S6K2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Confocal imaging of NIH/3T3 cells using p70 S6 Kinase beta/S6K2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Confocal imaging of U-2 OS cells using p70 S6 Kinase beta/S6K2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded human cervix cancer tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded mouse kidney tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded human colon carcinoma tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: p70 S6 Kinase beta/S6K2 Antibody (5D8F5) [NBP3-16752] - Immunohistochemistry analysis of p70 S6 Kinase beta/S6K2 in paraffin-embedded rat colon tissue using p70 S6 Kinase beta/S6K2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 5D8F5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

p70 S6 Kinase beta/S6K2 Antibody (5D8F5) Summary

• Description: Novus Biologicals Rabbit p70 S6 Kinase beta/S6K2 Antibody (5D8F5) (NBP3-16752) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase beta/S6K2 (Q9UBS0). MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RPS6KB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for p70 S6 Kinase beta/S6K2 Antibody (5D8F5)

• EC 2.7.11
• EC 2.7.11.1
• KLS
• p70 ribosomal S6 kinase beta
• p70 S6 Kinase beta
• p70 S6KB
• p70 S6K-beta
• p70(S6K)-beta
• p70-beta
• P70-beta-1
• P70-beta-2
• p70-S6K 2
• P70S6K2
• p70S6Kb
• ribosomal protein S6 kinase beta-2
• ribosomal protein S6 kinase, 70kD, polypeptide 2,70 kDa ribosomal protein S6 kinase 2
• ribosomal protein S6 kinase, 70kDa, polypeptide 2
• RPS6KB2
• S6K2
• S6K-beta
• S6K-beta2
• S6K-beta-2
• serine/threonine-protein kinase 14 beta
• Serine/threonine-protein kinase 14B
• SRK
• STK14B
• STK14BS6 kinase-related kinase

Background

S6K2 encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS6KB2