Coronin-1a Antibody (4G10) - Azide and BSA Free

Western Blot: Coronin-1a Antibody (4G10) [H00011151-M01] - CORO1A monoclonal antibody (M01), clone 4G10 Analysis of CORO1A expression in K-562.

Immunohistochemistry-Paraffin: Coronin-1a Antibody (4G10) [H00011151-M01] - Analysis of monoclonal antibody to CORO1A on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.

Sandwich ELISA: Coronin-1a Antibody (4G10) [H00011151-M01] - Detection limit for recombinant GST tagged CORO1A is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 4G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Coronin-1a Antibody (4G10) - Azide and BSA Free Summary

• Immunogen: CORO1A (NP_009005, 360 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
• Specificity: CORO1A - coronin, actin binding protein, 1A
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CORO1A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Coronin-1a Antibody (4G10) - Azide and BSA Free

• CLIPINA
• clipin-A
• CORO1
• coronin, actin binding protein, 1A
• coronin, actin-binding protein, 1A
• coronin-1
• coronin-1A
• Coronin-like protein A
• Coronin-like protein p57
• FLJ41407
• HCORO1
• MGC117380
• p57
• TACOCLABP
• Tryptophan aspartate-containing coat protein

Background

Coronin was originally discovered in Dictyostelium, where it was found to be involved in the chemotactic response of these ameboid cells. The name derives from the fact that the protein is localized at the leading edge or crown of these highly motile cells. The name derives from Corona, which is latin for crown. Coronin homologues have been found in yeast, C. elegans, Drosophila and many other species, and a family them are known in mammals. All coronins belong to the WD40 or WD family of proteins, the prototype or which is the beta subunit of trimeric G-proteins. Coronins appear to be particularly involved in binding to actin, actin associated proteins, tubulin and phospholipase C and have been implicated in the mechanisms of chemotaxis and phagocytosis. In mammals there are at least five major coronin proteins, named coronins 1 to 5 in one nomenclature. Another nomenclature divides these five proteins in coronins 1a and 1b, 2a, 2b and 2c. The mammalian coronin family members are abundant components of eukaryotic cells, and each type has a restricted cell type specific expression pattern. Coronin 1A is the mammalian coronin most similar in protein sequence to the Dictyostelium protein and is found exclusively in hematopoetic lineage cells such as lymphocytes, macrophages and neutrophils. NB 110-58867 is therefore an excellent marker of cells of this lineage and can also be used to study the leading edges particularly of neutrophils. Since the only hematopoetic cells found within the central nervous system are microglia, this antibody is also an excellent marker of this important cell type. Microglia are numerically fairly minor components of the nervous system, but microglial activation is seen in response to a wide variety of damage and disease states, including ALS, Alzheimer's disease and responses to brain tumors. Since coronin 1a is a constitutive component of microglia, the coronin 1a antibody can be used to study both quiescent and activated microglia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Coronin-1a Antibody (H00011151-M01)(5)

Publications using H00011151-M01

• Tohnyui F, Christelle B, Haiyan Z et al. An evolutionarily conserved coronin-dependent pathway defines cell population size. Sci Signal. 2022-11-08 [PMID: 36346836]
• Jayachandran R, Gumienny A, Bolinger B et al. Disruption of Coronin 1 Signaling in T Cells Promotes Allograft Tolerance while Maintaining Anti-Pathogen Immunity. Immunity. 2019-02-02 [PMID: 30611611]
• Jayachandran R, Liu X, Bosedasgupta S et al. Coronin 1 regulates cognition and behavior through modulation of cAMP/protein kinase A signaling. PLoS Biol. 2014-03-25 [PMID: 24667537]
• Federzoni EA, Humbert M, Valk PJ et al. The actin-binding protein CORO1A is a novel PU.1 (SPI1)- and CEBPA-regulated gene with significantly lower expression in APL and CEBPA-mutated AML patients. Br J Haematol. 2013-03-01 [PMID: 23252456] (Human)
• Moriceau S, Kantari C, Mocek J et al. Coronin-1 Is Associated with Neutrophil Survival and Is Cleaved during Apoptosis: Potential Implication in Neutrophils from Cystic Fibrosis Patients. J Immunol. 2009-06-01 [PMID: 19454722]

Bioinformatics

• Gene Symbol: CORO1A
• Entrez:
  • 11151(Human)
• OMIM:
  • 605000(Human)
• Uniprot:
  • NP_009005(Human)