GPR175 Antibody (6D7)

Images

 
Western Blot: GPR175 Antibody (6D7) [H00131601-M01] - Analysis of GPR175 over-expressed 293 cell line, cotransfected with GPR175 Validated Chimera RNAi ( Cat # H00131601-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: GPR175 Antibody (6D7) [H00131601-M01] - Analysis of GPR175 expression in transfected 293T cell line by GPR175 monoclonal antibody (M01), clone 6D7.Lane 1: GPR175 transfected lysate(41.053 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
6D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GPR175 Antibody (6D7) Summary

Immunogen
GPR175 (NP_057456, 281 a.a. ~ 372 a.a) partial recombinant protein with GST tag.RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEA AGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTD SERWKAI
Localization
Cell Membrane
Specificity
GPR175 - G protein-coupled receptor 175
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPRA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA and RNAi Validation.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR175 Antibody (6D7)

  • adipocyte associated 1
  • transmembrane protein, adipocyte asscociated 1

Background

This is an Orphan U member of the GCPR family that has been documented in human heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from B-cell/lung/testis, blood, brain, breast, eye, heart/melanocyte/uterus, liver, liver/spleen, lymph node, nerve, ovary, prostate, and uterus libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
H00008636-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP2-19428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB100-61040
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-86815
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84369
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40763
Species: Hu, Mu, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76243
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR175 Antibody (H00131601-M01) (0)

There are no publications for GPR175 Antibody (H00131601-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR175 Antibody (H00131601-M01) (0)

There are no reviews for GPR175 Antibody (H00131601-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR175 Antibody (H00131601-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR175 Products

Bioinformatics Tool for GPR175 Antibody (H00131601-M01)

Discover related pathways, diseases and genes to GPR175 Antibody (H00131601-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR175 Antibody (H00131601-M01)

Discover more about diseases related to GPR175 Antibody (H00131601-M01).

Research Areas for GPR175 Antibody (H00131601-M01)

Find related products by research area.

Blogs on GPR175

There are no specific blogs for GPR175, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR175 Antibody (6D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TPRA1
Entrez
OMIM
Uniprot