Corneodesmosin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining in human skin and pancreas tissues using anti-CDSN antibody. Corresponding CDSN RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human kidney, liver, pancreas and skin using Anti-CDSN antibody NBP2-47501 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human skin shows membranous positivity in stratum corneum and stratum granulosum.
Immunohistochemistry-Paraffin: Corneodesmosin Antibody [NBP2-47501] - Staining of human kidney shows no positivity in cells in tubules as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Corneodesmosin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG
Specificity
Specificity of human Corneodesmosin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDSN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID:32218450).
Control Peptide
Corneodesmosin Protein (NBP2-47501PEP)
Publications
Read Publication using
NBP2-47501 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Corneodesmosin Antibody

  • CDSN
  • Corneodesmosin
  • D6S586E
  • differentiated keratinocyte S protein
  • HTSS
  • S protein
  • S

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF944
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-04611
Species: Hu
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
MAB2350
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-56484
Species: Hu
Applications: WB, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for Corneodesmosin Antibody (NBP2-47501)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Corneodesmosin Antibody (NBP2-47501) (0)

There are no reviews for Corneodesmosin Antibody (NBP2-47501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Corneodesmosin Antibody (NBP2-47501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Corneodesmosin Products

Bioinformatics Tool for Corneodesmosin Antibody (NBP2-47501)

Discover related pathways, diseases and genes to Corneodesmosin Antibody (NBP2-47501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Corneodesmosin Antibody (NBP2-47501)

Discover more about diseases related to Corneodesmosin Antibody (NBP2-47501).
 

Pathways for Corneodesmosin Antibody (NBP2-47501)

View related products by pathway.

PTMs for Corneodesmosin Antibody (NBP2-47501)

Learn more about PTMs related to Corneodesmosin Antibody (NBP2-47501).

Blogs on Corneodesmosin

There are no specific blogs for Corneodesmosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Corneodesmosin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDSN