Reactivity | HuSpecies Glossary |
Applications | ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
Specificity | Specificity of human Corneodesmosin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CDSN |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID:32218450). |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-47501 | Applications | Species |
---|---|---|
Ipponjima S, Umino Y, Nagayama M, Denda M Live imaging of alterations in cellular morphology and organelles during cornification using an epidermal equivalent model Sci Rep Mar 26 2020 [PMID: 32218450] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for Corneodesmosin Antibody (NBP2-47501)Discover more about diseases related to Corneodesmosin Antibody (NBP2-47501).
| Pathways for Corneodesmosin Antibody (NBP2-47501)View related products by pathway.
|
PTMs for Corneodesmosin Antibody (NBP2-47501)Learn more about PTMs related to Corneodesmosin Antibody (NBP2-47501).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CDSN |