Contactin-2/TAG1 Antibody

Images

 
Immunohistochemistry-Paraffin: Contactin-2/TAG1 Antibody [NBP1-90054] - Staining of human skeletal muscle shows positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Contactin-2/TAG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Contactin-2/TAG1 Protein (NBP1-90054PEP)
Publications
Read Publication using NBP1-90054.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28781169).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Contactin-2/TAG1 Antibody

  • Axonal glycoprotein TAG-1
  • axonin-1 cell adhesion molecule
  • Axonin-1
  • AXT
  • CNTN2
  • contactin 2 (axonal)
  • contactin 2 (transiently expressed)
  • Contactin2
  • Contactin-2
  • DKFZp781D102
  • FLJ37193
  • MGC157722
  • TAG1
  • TAG-1
  • TAX
  • TAX1
  • TAX-1
  • TAX1FLJ42746
  • Transient axonal glycoprotein 1
  • transiently-expressed axonal glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2034
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1310
Species: Hu
Applications: WB, IHC, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-90054
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Contactin-2/TAG1 Antibody (NBP1-90054)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Contactin-2/TAG1 Antibody (NBP1-90054) (0)

There are no reviews for Contactin-2/TAG1 Antibody (NBP1-90054). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Contactin-2/TAG1 Antibody (NBP1-90054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Contactin-2/TAG1 Products

Bioinformatics Tool for Contactin-2/TAG1 Antibody (NBP1-90054)

Discover related pathways, diseases and genes to Contactin-2/TAG1 Antibody (NBP1-90054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Contactin-2/TAG1 Antibody (NBP1-90054)

Discover more about diseases related to Contactin-2/TAG1 Antibody (NBP1-90054).
 

Pathways for Contactin-2/TAG1 Antibody (NBP1-90054)

View related products by pathway.

PTMs for Contactin-2/TAG1 Antibody (NBP1-90054)

Learn more about PTMs related to Contactin-2/TAG1 Antibody (NBP1-90054).

Blogs on Contactin-2/TAG1

There are no specific blogs for Contactin-2/TAG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Contactin-2/TAG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTN2
Entrez