Contactin-2/TAG1 Antibody (4R2S3)

Western Blot: Contactin-2/TAG1 Antibody (4R2S3) [NBP3-16571] - Western blot analysis of extracts of various cell lines, using Contactin-2/TAG1 Rabbit mAb (NBP3-16571) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 4R2S3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Contactin-2/TAG1 Antibody (4R2S3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin-2/TAG1 (Q02246). MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CNTN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Contactin-2/TAG1 Antibody (4R2S3)

• Axonal glycoprotein TAG-1
• axonin-1 cell adhesion molecule
• Axonin-1
• AXT
• CNTN2
• contactin 2 (axonal)
• contactin 2 (transiently expressed)
• Contactin2
• Contactin-2
• DKFZp781D102
• FLJ37193
• MGC157722
• TAG1
• TAG-1
• TAX
• TAX1
• TAX-1
• TAX1FLJ42746
• Transient axonal glycoprotein 1
• transiently-expressed axonal glycoprotein

Background

Contactin 2 is encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention.; ; May play a role in the initial growth and guidance of axons. May be involved in cell adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNTN2