Complement Factor D/Adipsin Antibody Summary
| Immunogen |
Synthetic peptide directed towards the C terminal of human CFD. Peptide sequence GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CFD |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CFD and was validated on Western blot. |
| Theoretical MW |
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Complement Factor D/Adipsin Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Publications for Complement Factor D/Adipsin Antibody (NBP1-79793) (0)
There are no publications for Complement Factor D/Adipsin Antibody (NBP1-79793).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Complement Factor D/Adipsin Antibody (NBP1-79793) (0)
There are no reviews for Complement Factor D/Adipsin Antibody (NBP1-79793).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Complement Factor D/Adipsin Antibody (NBP1-79793) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Complement Factor D/Adipsin Products
Bioinformatics Tool for Complement Factor D/Adipsin Antibody (NBP1-79793)
Discover related pathways, diseases and genes to Complement Factor D/Adipsin Antibody (NBP1-79793). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Complement Factor D/Adipsin Antibody (NBP1-79793)
Discover more about diseases related to Complement Factor D/Adipsin Antibody (NBP1-79793).
| | Pathways for Complement Factor D/Adipsin Antibody (NBP1-79793)
View related products by pathway.
|
PTMs for Complement Factor D/Adipsin Antibody (NBP1-79793)
Learn more about PTMs related to Complement Factor D/Adipsin Antibody (NBP1-79793).
|
Blogs on Complement Factor D/Adipsin
![Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793] - Sample Tissue: Human U937 Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize2/Complement-Factor-D-Adipsin-Antibody-Western-Blot-NBP1-79793-img0004.jpg "Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793] - Sample Tissue: Human U937 Antibody Dilution: 1.0 ug/ml")
![IL-6 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-6 [Unconjugated]")
![Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.](http://images.novusbio.com/fullsize2/Complement-Factor-D-Adipsin-Antibody-Western-Blot-NBP1-79793-img0003.jpg "Western Blot: Complement Factor D/Adipsin Antibody [NBP1-79793] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.")
![Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).](http://images.novusbio.com/fullsize2/Complement-C3-Antibody-(11H9)-Flow-(Intracellular)-NB200-540-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.](http://images.novusbio.com/fullsize2/Complement-C3-Antibody-(11H9)-Immunocytochemistry-Immunofluorescence-NB200-540-img0002.jpg)
![Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.](http://images.novusbio.com/fullsize2/Complement-C3-Antibody-(11H9)-Immunohistochemistry-Paraffin-NB200-540-img0004.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0004.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Western-Blot-NBP1-89985-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89985-img0010.jpg)
![Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Complement-Factor-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89985-img0015.jpg)
![Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.](http://images.novusbio.com/fullsize2/ATP6V0A2-Antibody-Western-Blot-NBP1-59069-img0002.jpg)
![Immunohistochemistry: ATP6V0A2 Antibody [NBP1-59069] - Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody](http://images.novusbio.com/fullsize2/ATP6V0A2-Antibody-Immunohistochemistry-NBP1-59069-img0008.jpg)
![Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize2/ATP6V0A2-Antibody-Western-Blot-NBP1-59069-img0001.jpg)
![Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).](http://images.novusbio.com/fullsize2/Neurofibromin 1 Antibody-Western Blot-NB300-155-img0004.jpg)
![Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.](http://images.novusbio.com/fullsize2/Neurofibromin 1 Antibody-Immunohistochemistry-NB300-155-img0003.jpg)
![Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP1-49879] - Paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/fullsize2/Desmoplakin-Antibody-Immunohistochemistry-Paraffin-NBP1-49879-img0001.jpg)
![Western Blot: PTGDR Antibody [H00005729-B01P] - Analysis of PTGDR expression in transfected 293T cell line by PTGDR polyclonal antibody. Lane 1: PTGDR transfected lysate(39.6 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize2/PTGDR Antibody-Western Blot-H00005729-B01P-img0004.jpg)
![Flow Cytometry: PTGDR Antibody [H00005729-B01P] - Analysis of negative control 293 cells (Black) and PTGDR expressing 293 cells (Green) using PTGDR purified mouse polyclonal antibody.](http://images.novusbio.com/fullsize2/PTGDR-Antibody-Flow-Cytometry-H00005729-B01P-img0003.jpg)
![Western Blot: SRPR alpha Antibody [NBP1-32421] - Sample(30 ug of whole cell lysate) A:293T B:A431 7.5% SDS PAGE diluted at 1:1000](http://images.novusbio.com/fullsize2/SRPR-alpha-Antibody-Western-Blot-NBP1-32421-img0007.jpg)
![Immunohistochemistry-Paraffin: SRPR alpha Antibody [NBP1-32421] - Paraffin-embedded GASTRIC CA, using antibody at 1:100 dilution.](http://images.novusbio.com/fullsize2/SRPR-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-32421-img0005.jpg)
![Western Blot: SRPR alpha Antibody [NBP1-32421] - Sample (50 ug of whole cell lysate) A: mouse liver 7.5% SDS PAGE diluted at 1:100](http://images.novusbio.com/fullsize2/SRPR-alpha-Antibody-Western-Blot-NBP1-32421-img0006.jpg)
![Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.](http://images.novusbio.com/fullsize2/PPAR-gamma-NR1C3-Antibody-Western-Blot-NBP2-22106-img0003.jpg)
![Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.](http://images.novusbio.com/fullsize2/PPAR-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-22106-img0001.jpg)
![Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.](http://images.novusbio.com/fullsize2/PPAR-gamma-Antibody-Western-Blot-NBP2-22106-img0002.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.](http://images.novusbio.com/fullsize2/Catalase-Antibody-Western-Blot-NBP2-24916-img0001.jpg)
![Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.](http://images.novusbio.com/fullsize2/Catalase-Antibody-Immunohistochemistry-Paraffin-NBP2-24916-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")
