Complement Factor D/Adipsin Antibody Summary
| Immunogen |
Synthetic peptide directed towards the C terminal of human CFD. Peptide sequence GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CFD |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CFD and was validated on Western blot. |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Complement Factor D/Adipsin Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Publications for Complement Factor D/Adipsin Antibody (NBP1-79793) (0)
There are no publications for Complement Factor D/Adipsin Antibody (NBP1-79793).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Complement Factor D/Adipsin Antibody (NBP1-79793) (0)
There are no reviews for Complement Factor D/Adipsin Antibody (NBP1-79793).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Complement Factor D/Adipsin Antibody (NBP1-79793) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Complement Factor D/Adipsin Products
Bioinformatics Tool for Complement Factor D/Adipsin Antibody (NBP1-79793)
Discover related pathways, diseases and genes to Complement Factor D/Adipsin Antibody (NBP1-79793). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Complement Factor D/Adipsin Antibody (NBP1-79793)
Discover more about diseases related to Complement Factor D/Adipsin Antibody (NBP1-79793).
| | Pathways for Complement Factor D/Adipsin Antibody (NBP1-79793)
View related products by pathway.
|
PTMs for Complement Factor D/Adipsin Antibody (NBP1-79793)
Learn more about PTMs related to Complement Factor D/Adipsin Antibody (NBP1-79793).
|
Blogs on Complement Factor D/Adipsin