Complement C4a Antibody

Images

 
Immunohistochemistry: Complement C4a Antibody [NBP2-46783] - Staining of human duodenum shows positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement C4a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Complement C4a Recombinant Protein Antigen (NBP2-46783PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement C4a Antibody

  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2
  • C4
  • complement component 4A (Rodgers blood group)
  • RG

Background

C4A - complement component 4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP3-12295
Species: Hu, Pm
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
DY2037
Species: Hu
Applications: ELISA
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
DCRP00
Species: Hu
Applications: ELISA
DIP100
Species: Hu
Applications: ELISA
H00000730-D01P
Species: Hu, Mu
Applications: WB
NB100-56725
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
NBP2-46783
Species: Hu
Applications: IHC, IHC-P

Publications for Complement C4a Antibody (NBP2-46783) (0)

There are no publications for Complement C4a Antibody (NBP2-46783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C4a Antibody (NBP2-46783) (0)

There are no reviews for Complement C4a Antibody (NBP2-46783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Complement C4a Antibody (NBP2-46783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement C4a Products

Bioinformatics Tool for Complement C4a Antibody (NBP2-46783)

Discover related pathways, diseases and genes to Complement C4a Antibody (NBP2-46783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement C4a Antibody (NBP2-46783)

Discover more about diseases related to Complement C4a Antibody (NBP2-46783).
 

Pathways for Complement C4a Antibody (NBP2-46783)

View related products by pathway.

PTMs for Complement C4a Antibody (NBP2-46783)

Learn more about PTMs related to Complement C4a Antibody (NBP2-46783).
 

Research Areas for Complement C4a Antibody (NBP2-46783)

Find related products by research area.

Blogs on Complement C4a

There are no specific blogs for Complement C4a, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement C4a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4A
Entrez
Uniprot