Collagen VI alpha 3 Antibody

Images

 
Western Blot: Collagen VI alpha 3 Antibody [NBP2-34837] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human ovary shows moderate cytoplasmic positivity in ovarian stromal cells.
Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane view shows a specific band for Collagen IV alpha3 in 0.2 mg/ml of WI-38 lysate(s). This experiment was performed under reducing conditions using the ...read more
Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Electropherogram image of the corresponding Simple Western lane view. Collagen IV alpha3 antibody was used at 1:25 dilution on WI-38 lysate(s) respectively.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Collagen VI alpha 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL6A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Collagen VI alpha 3 Recombinant Protein Antigen (NBP2-34837PEP)

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen VI alpha 3 Antibody

  • Collagen Alpha-3(VI) Chain
  • Collagen VI, Alpha-3 Polypeptide
  • collagen, type VI, alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6588
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00001292-M01
Species: Hu, Po
Applications: WB, ELISA, ICC/IF
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-58529
Species: Hu
Applications: ICC/IF
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-05118
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2667
Species: Hu
Applications: WB, IHC
NBP2-34837
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Collagen VI alpha 3 Antibody (NBP2-34837) (0)

There are no publications for Collagen VI alpha 3 Antibody (NBP2-34837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VI alpha 3 Antibody (NBP2-34837) (0)

There are no reviews for Collagen VI alpha 3 Antibody (NBP2-34837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen VI alpha 3 Antibody (NBP2-34837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen VI alpha 3 Products

Bioinformatics Tool for Collagen VI alpha 3 Antibody (NBP2-34837)

Discover related pathways, diseases and genes to Collagen VI alpha 3 Antibody (NBP2-34837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen VI alpha 3 Antibody (NBP2-34837)

Discover more about diseases related to Collagen VI alpha 3 Antibody (NBP2-34837).
 

Pathways for Collagen VI alpha 3 Antibody (NBP2-34837)

View related products by pathway.

PTMs for Collagen VI alpha 3 Antibody (NBP2-34837)

Learn more about PTMs related to Collagen VI alpha 3 Antibody (NBP2-34837).

Blogs on Collagen VI alpha 3

There are no specific blogs for Collagen VI alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen VI alpha 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL6A3