Collagen VI alpha 3 Antibody - BSA Free

Western Blot: Collagen VI alpha 3 Antibody [NBP2-34837] - Analysis in human cell line U-87 MG.

Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human placenta shows moderate cytoplasmic positivity in connective tissues.

Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human ovary shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Collagen VI alpha 3 Antibody [NBP2-34837] - Staining of human cerebral cortex shows no positivity in neurons.

Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Lane view shows a specific band for Collagen IV alpha3 in 0.2 mg/ml of WI-38 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Collagen VI alpha 3 Antibody [NBP2-34837] - Electropherogram image of the corresponding Simple Western lane view. Collagen IV alpha3 antibody was used at 1:25 dilution on WI-38 lysate(s) respectively.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC, mIF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Collagen VI alpha 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL6A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Multiplex Immunofluorescence
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Collagen VI alpha 3 Recombinant Protein Antigen (NBP2-34837PEP)

Reactivity Notes

Expected to cross react based on sequence identity: Mouse (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Collagen VI alpha 3 Antibody - BSA Free

• Collagen Alpha-3(VI) Chain
• Collagen VI, Alpha-3 Polypeptide
• collagen, type VI, alpha 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL6A3