Collagen VI alpha 2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
COL6A2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Simple Western 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: separated by Size, antibody dilution of 1:50 |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Collagen VI alpha 2 Antibody - BSA Free
Background
Collagen VI alpha 2 belongs to the type VI collagen family and acts as a cell-binding protein as well as having a role in extracellular matrix upkeep. Collagen VI alpha 2 has been studied in relation to Bethlem myopathy and Ullrich scleroatonic muscular dystrophy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Fe, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PCR, WB
Species: Hu
Applications: ELISA
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Ca, Ch(-), Gp(-), Hu, Ma, Mu(-), Po, Rb, Rt(-), Sh
Applications: ELISA, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: Simple Western, IHC
Publications for Collagen VI alpha 2 Antibody (NBP1-90951)(2)
Showing Publications 1 -
2 of 2.
Reviews for Collagen VI alpha 2 Antibody (NBP1-90951) (0)
There are no reviews for Collagen VI alpha 2 Antibody (NBP1-90951).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Collagen VI alpha 2 Antibody (NBP1-90951) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Collagen VI alpha 2 Products
Blogs on Collagen VI alpha 2