Collagen VI alpha 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP1-90951] - Staining of human gastrointestinal, pancreas, placenta and prostate using Anti-COL6A2 antibody NBP1-90951 (A) shows similar protein distribution across tissues to independent antibody NBP2-55655 (B).

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP1-90951] - Staining of human prostate shows moderate to strong membranous and cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP1-90951] - Staining of human colon shows strong positivity in extracellular matrix in lamina propria.

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP1-90951] - Staining of human pancreas shows only very weak positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Collagen VI alpha 2 Antibody [NBP1-90951] - Staining of human placenta shows strong positivity in extracellular matrix in chorionic vlli.

• Reactivity: Hu
• Applications: Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Collagen VI alpha 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Collagen VI alpha 2 Antibody - BSA Free (NBP1-90951) is a polyclonal antibody validated for use in IHC and Simple Western. Anti-Collagen VI alpha 2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL6A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: separated by Size, antibody dilution of 1:50
• Control Peptide:

  Collagen VI alpha 2 Protein (NBP1-90951PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Collagen VI alpha 2 Antibody - BSA Free

• collagen alpha-2(VI) chain
• collagen VI, alpha-2 polypeptide
• collagen, type VI, alpha 2,10PP3610
• DKFZp586E1322
• FLJ46862

Background

Collagen VI alpha 2 belongs to the type VI collagen family and acts as a cell-binding protein as well as having a role in extracellular matrix upkeep. Collagen VI alpha 2 has been studied in relation to Bethlem myopathy and Ullrich scleroatonic muscular dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Collagen VI alpha 2 Antibody (NBP1-90951)(2)

Publications using NBP1-90951

• Ghosh Z, Huang M, Hu S et al. Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells. Cancer Res 2011-07-15 [PMID: 21646469]
• Liu Y, Carson-Walter EB, Cooper A et al. Vascular gene expression patterns are conserved in primary and metastatic brain tumors. J Neurooncol 2010-08-01 [PMID: 20063114]

Bioinformatics

• Gene Symbol: COL6A2