Collagen V alpha 2 Antibody (3G11)


Immunocytochemistry/ Immunofluorescence: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Analysis of monoclonal antibody to COL5A2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Detection limit for recombinant GST tagged COL5A2 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

Collagen V alpha 2 Antibody (3G11) Summary

COL5A2 (NP_000384, 41 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV
This product is specific for Human COL5A2 monoclonal antibody (M02), clone 3G11 [Gene ID: 1290].
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Collagen V alpha 2 Antibody (3G11)

  • AB collagen
  • collagen alpha-2(V) chain
  • collagen, fetal membrane, A polypeptide
  • collagen, type V, alpha 2
  • MGC105115
  • type V preprocollagen alpha 2 chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Fe, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: AC
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
Species: Hu
Applications: ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Fe, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no publications for Collagen V alpha 2 Antibody (H00001290-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no reviews for Collagen V alpha 2 Antibody (H00001290-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Collagen V alpha 2 Antibody (H00001290-M02)

Discover related pathways, diseases and genes to Collagen V alpha 2 Antibody (H00001290-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen V alpha 2 Antibody (H00001290-M02)

Discover more about diseases related to Collagen V alpha 2 Antibody (H00001290-M02).

Pathways for Collagen V alpha 2 Antibody (H00001290-M02)

View related products by pathway.

PTMs for Collagen V alpha 2 Antibody (H00001290-M02)

Learn more about PTMs related to Collagen V alpha 2 Antibody (H00001290-M02).

Blogs on Collagen V alpha 2

There are no specific blogs for Collagen V alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Collagen V alpha 2 Antibody (3G11) and receive a gift card or discount.


Gene Symbol COL5A2