Collagen V alpha 2 Antibody (3G11)


Immunocytochemistry/ Immunofluorescence: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Analysis of monoclonal antibody to COL5A2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Detection limit for recombinant GST tagged COL5A2 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

Collagen V alpha 2 Antibody (3G11) Summary

COL5A2 (NP_000384, 41 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV
This product is specific for Human COL5A2 monoclonal antibody (M02), clone 3G11 [Gene ID: 1290].
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Collagen V alpha 2 Antibody (3G11)

  • AB collagen
  • collagen alpha-2(V) chain
  • collagen, fetal membrane, A polypeptide
  • collagen, type V, alpha 2
  • MGC105115
  • type V preprocollagen alpha 2 chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Ca
Applications: ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
Species: Hu
Applications: ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no publications for Collagen V alpha 2 Antibody (H00001290-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no reviews for Collagen V alpha 2 Antibody (H00001290-M02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Collagen V alpha 2 Antibody (3G11) Products

Related Products by Gene

Bioinformatics Tool for Collagen V alpha 2 Antibody (H00001290-M02)

Discover related pathways, diseases and genes to Collagen V alpha 2 Antibody (H00001290-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen V alpha 2 Antibody (H00001290-M02)

Discover more about diseases related to Collagen V alpha 2 Antibody (H00001290-M02).

Pathways for Collagen V alpha 2 Antibody (H00001290-M02)

View related products by pathway.

PTMs for Collagen V alpha 2 Antibody (H00001290-M02)

Learn more about PTMs related to Collagen V alpha 2 Antibody (H00001290-M02).

Blogs on Collagen V alpha 2

There are no specific blogs for Collagen V alpha 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Collagen V alpha 2 Antibody (3G11) and receive a gift card or discount.


Gene Symbol COL5A2

Customers Who Bought This Also Bought