Collagen V alpha 2 Antibody (3G11)

Images

 
Immunocytochemistry/ Immunofluorescence: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Analysis of monoclonal antibody to COL5A2 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Detection limit for recombinant GST tagged COL5A2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Collagen V alpha 2 Antibody (3G11) Summary

Immunogen
COL5A2 (NP_000384, 41 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV
Specificity
This product is specific for Human COL5A2 monoclonal antibody (M02), clone 3G11 [Gene ID: 1290].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COL5A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Collagen V alpha 2 Antibody (3G11)

  • AB collagen
  • collagen alpha-2(V) chain
  • collagen, fetal membrane, A polypeptide
  • collagen, type V, alpha 2
  • MGC105115
  • type V preprocollagen alpha 2 chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-05118
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-05169
Species: Hu, Ca
Applications: ELISA, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58159
Species: Hu
Applications: ICC/IF
NBP2-33343
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-6586
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-34837
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
AF6318
Species: Hu
Applications: ICC
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-21374
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
MAB3487
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC
NB120-6588
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no publications for Collagen V alpha 2 Antibody (H00001290-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no reviews for Collagen V alpha 2 Antibody (H00001290-M02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen V alpha 2 Antibody (3G11) Products

Related Products by Gene

Bioinformatics Tool for Collagen V alpha 2 Antibody (H00001290-M02)

Discover related pathways, diseases and genes to Collagen V alpha 2 Antibody (H00001290-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen V alpha 2 Antibody (H00001290-M02)

Discover more about diseases related to Collagen V alpha 2 Antibody (H00001290-M02).
 

Pathways for Collagen V alpha 2 Antibody (H00001290-M02)

View related products by pathway.

PTMs for Collagen V alpha 2 Antibody (H00001290-M02)

Learn more about PTMs related to Collagen V alpha 2 Antibody (H00001290-M02).

Blogs on Collagen V alpha 2

There are no specific blogs for Collagen V alpha 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen V alpha 2 Antibody (3G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol COL5A2
Uniprot

Customers Who Bought This Also Bought