COL14A1 Antibody

Western Blot: COL14A1 Antibody [NBP1-86877] - Analysis in human plasma.

Immunocytochemistry/Immunofluorescence: COL14A1 Antibody [NBP1-86877] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human prostate shows positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human cervix, uterine shows membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human liver shows granular cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

COL14A1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL14A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. COL14A1 antibody validated for IHC-F from a verified customer review.
• Control Peptide:

  COL14A1 Protein (NBP1-86877PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for COL14A1 Antibody

• collagen alpha-1(XIV) chain
• collagen, type XIV, alpha 1
• undulin (fibronectin-tenascin-related)
• Undulin
• UNDundulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COL14A1 Antibody (NBP1-86877)(1)

Publication using NBP1-86877

• Gutierrez HL, Tsutsumi R, Moore TY, Cooper KL Convergent metatarsal fusion in jerboas and chickens is mediated by similarities and differences in the patterns of osteoblast and osteoclast activities Evol Dev 2019-10-22 [PMID: 31631508]

Bioinformatics

• Gene Symbol: COL14A1