COL14A1 Antibody


Western Blot: COL14A1 Antibody [NBP1-86877] - Analysis in human plasma.
Immunocytochemistry/ Immunofluorescence: COL14A1 Antibody [NBP1-86877] - Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human prostate shows positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human cervix, uterine shows membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: COL14A1 Antibody [NBP1-86877] - Staining of human liver shows granular cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

COL14A1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR
Specificity of human COL14A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COL14A1 Protein (NBP1-86877PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COL14A1 Antibody

  • collagen alpha-1(XIV) chain
  • collagen, type XIV, alpha 1
  • undulin (fibronectin-tenascin-related)
  • Undulin
  • UNDundulin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COL14A1 Antibody (NBP1-86877) (0)

There are no publications for COL14A1 Antibody (NBP1-86877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL14A1 Antibody (NBP1-86877) (0)

There are no reviews for COL14A1 Antibody (NBP1-86877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COL14A1 Antibody (NBP1-86877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional COL14A1 Products

Bioinformatics Tool for COL14A1 Antibody (NBP1-86877)

Discover related pathways, diseases and genes to COL14A1 Antibody (NBP1-86877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL14A1 Antibody (NBP1-86877)

Discover more about diseases related to COL14A1 Antibody (NBP1-86877).

Pathways for COL14A1 Antibody (NBP1-86877)

View related products by pathway.

PTMs for COL14A1 Antibody (NBP1-86877)

Learn more about PTMs related to COL14A1 Antibody (NBP1-86877).

Blogs on COL14A1

There are no specific blogs for COL14A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COL14A1 Antibody and receive a gift card or discount.


Gene Symbol COL14A1