Collagen XII alpha1 Antibody

Images

 
Western Blot: Collagen XII alpha1 Antibody [NBP1-88062] - Analysis in human cell lines U2OS and A-431 using Anti-COL12A1 antibody. Corresponding COL12A1 RNA-seq data are presented for the same cell lines. Loading ...read more
Immunohistochemistry-Paraffin: Collagen XII alpha1 Antibody [NBP1-88062] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.
Western Blot: Collagen XII alpha1 Antibody [NBP1-88062] - Analysis in human cell line SiHa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Collagen XII alpha1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL12A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
Collagen XII alpha1 Protein (NBP1-88062PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen XII alpha1 Antibody

  • BA209D8.1
  • COL12A1L
  • collagen alpha-1(XII) chain
  • collagen type XII proteoglycan
  • collagen, type XII, alpha 1
  • DJ234P15.1
  • type XII, alpha 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05118
Species: Hu, Po, Bv, Ca, Kg, Rb, Sh, Ch(-), Gp(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
27260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15940
Species: Hu
Applications: WB, IHC, IHC-P
H00001290-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-80799
Species: Hu
Applications: IHC, IHC-P
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP2-14130
Species: Hu
Applications: IHC, IHC-P
NB120-6588
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Collagen XII alpha1 Antibody (NBP1-88062) (0)

There are no publications for Collagen XII alpha1 Antibody (NBP1-88062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XII alpha1 Antibody (NBP1-88062) (0)

There are no reviews for Collagen XII alpha1 Antibody (NBP1-88062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XII alpha1 Antibody (NBP1-88062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen XII alpha1 Products

Bioinformatics Tool for Collagen XII alpha1 Antibody (NBP1-88062)

Discover related pathways, diseases and genes to Collagen XII alpha1 Antibody (NBP1-88062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XII alpha1 Antibody (NBP1-88062)

Discover more about diseases related to Collagen XII alpha1 Antibody (NBP1-88062).
 

Pathways for Collagen XII alpha1 Antibody (NBP1-88062)

View related products by pathway.

Blogs on Collagen XII alpha1

There are no specific blogs for Collagen XII alpha1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen XII alpha1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL12A1