Collagen XII alpha1 Antibody - BSA Free

Staining of human colon shows moderate cytoplasmic positivity in smooth muscle and glandular cells.

Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human endometrium shows moderate cytoplasmic positivity in stromal cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Collagen XII alpha1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Collagen XII alpha1 Antibody - BSA Free (NBP1-88062) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Collagen XII alpha1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL12A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: IHC-P, HIER pH6 retrieval is recommended.
• Control Peptide:

  Collagen XII alpha1 Protein (NBP1-88062PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Collagen XII alpha1 Antibody - BSA Free

• BA209D8.1
• COL12A1L
• collagen alpha-1(XII) chain
• collagen type XII proteoglycan
• collagen, type XII, alpha 1
• DJ234P15.1
• type XII, alpha 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Collagen XII alpha1 Antibody (NBP1-88062)(5)

Publications using NBP1-88062

• Endzhievskaya S, Hsu CK, Yang HS et al. Loss of RhoE function in dermatofibroma promotes disorganized dermal fibroblast extracellular matrix and increased integrin activation The Journal of investigative dermatology 2023-02-10 [PMID: 36774976] (WB, ICC/IF, Human)
• Rigi M, Son HS, Moon L et al. Collagen type XII is undetectable in keratoconus Bowman's layer The British journal of ophthalmology 2023-02-06 [PMID: 36746614]
• MondragOn E, Cowdin M, Taraballi F et al. Mimicking the Organic and Inorganic Composition of Anabolic Bone Enhances Human Mesenchymal Stem Cell Osteoinduction and Scaffold Mechanical Properties Front Bioeng Biotechnol 2020-07-03 [PMID: 32719790] (PCR, ICC/IF, Human)
• McNeill EP, Zeitouni S, Pan S et al. Characterization of a pluripotent stem cell-derived matrix with powerful osteoregenerative capabilities Nat Commun 2020-06-15 [PMID: 32541821] (WB, ICC, Human)
• Sears C, Mondragon E, Richards Zi et Al. Conditioning of 3D Printed Nanoengineered Ionic-Covalent Entanglement Scaffolds with iP-hMSCs Derived Matrix Adv Healthc Mater 2020-03-08 [PMID: 32147960]

Review for Collagen XII alpha1 Antibody (NBP1-88062) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Eli Mondragon Immunofluorescence + Western Blot Human 02/06/2020

Summary

• Application: Other
• Sample Tested: Extracellular Matrix
• Species: Human
• Lot: B117630

Comments

• Comments: Samples are purified iP-hMSCs-derived extracellular matrix (ECM) grown in monolayer. Performed immunofluorescence, new application. Performed western to verify the presence of Coll XII in the same set of samples.

Bioinformatics

• Gene Symbol: COL12A1