Coagulation Factor III/Tissue Factor Antibody

Images

 
Western Blot: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Coagulation Factor III/Tissue Factor Antibody [NBP2-55950] - Staining of human cell line HaCaT shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Coagulation Factor III/Tissue Factor Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV
Specificity
Specificity of human Coagulation Factor III/Tissue Factor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
F3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Coagulation Factor III/Tissue Factor Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Coagulation Factor III/Tissue Factor Antibody

  • CD142 antigen
  • CD142
  • coagulation factor III (thromboplastin, tissue factor)
  • Coagulation Factor III
  • F3
  • FLJ17960
  • TF
  • TFA
  • Thromboplastin
  • Tissue Factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Sh, Ze
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005555-P01
Species: Hu
NB600-930
Species: Hu
Applications: WB, ELISA
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2818
Species: Hu
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
AF6796
Species: Hu
Applications: WB, ICC
NBP1-59130
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC
NBP2-55950
Species: Hu
Applications: WB, ICC/IF

Publications for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950) (0)

There are no publications for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950) (0)

There are no reviews for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950). (Showing 1 - 1 of 1 FAQ).

  1. Have you tested any of your anti-tissue factor antibodies against pig? I need one for western blot.
    • Unfortunately, none of our Tissue Factor antibodies have yet been tested with pig samples, so we cannot guarantee that any of them will work in pig. Here is a link to Tissue Factor antibodies that have been validated for use in Western blot. If you are interested in testing any of these antibodies against pig samples, you could become eligible for our Innovator's Reward program.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Coagulation Factor III/Tissue Factor Products

Bioinformatics Tool for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950)

Discover related pathways, diseases and genes to Coagulation Factor III/Tissue Factor Antibody (NBP2-55950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950)

Discover more about diseases related to Coagulation Factor III/Tissue Factor Antibody (NBP2-55950).
 

Pathways for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950)

View related products by pathway.

PTMs for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950)

Learn more about PTMs related to Coagulation Factor III/Tissue Factor Antibody (NBP2-55950).
 

Research Areas for Coagulation Factor III/Tissue Factor Antibody (NBP2-55950)

Find related products by research area.

Blogs on Coagulation Factor III/Tissue Factor

There are no specific blogs for Coagulation Factor III/Tissue Factor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coagulation Factor III/Tissue Factor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol F3