TSTA3 Antibody


Western Blot: TSTA3 Antibody [NBP1-83408] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: TSTA3 Antibody [NBP1-83408] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: TSTA3 Antibody [NBP1-83408] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in Leydig cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TSTA3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG
Specificity of human TSTA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TSTA3 Protein (NBP1-83408PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TSTA3 Antibody

  • EC
  • FX
  • GDP-4-keto-6-deoxy-D-mannose epimerase-reductase
  • GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase
  • GDP-L-fucose synthase
  • P35B
  • Protein FX
  • Red cell NADP(H)-binding protein
  • SDR4E13-5 epimerase/4-reductase
  • short chain dehydrogenase/reductase family 4E, member 1
  • Short-chain dehydrogenase/reductase family 4E member 1
  • tissue specific transplantation antigen 3
  • tissue specific transplantation antigen P35B
  • Tissue-specific transplantation antigen-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TSTA3 Antibody (NBP1-83408) (0)

There are no publications for TSTA3 Antibody (NBP1-83408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSTA3 Antibody (NBP1-83408) (0)

There are no reviews for TSTA3 Antibody (NBP1-83408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TSTA3 Antibody (NBP1-83408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TSTA3 Antibody (NBP1-83408)

Discover related pathways, diseases and genes to TSTA3 Antibody (NBP1-83408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSTA3 Antibody (NBP1-83408)

Discover more about diseases related to TSTA3 Antibody (NBP1-83408).

Pathways for TSTA3 Antibody (NBP1-83408)

View related products by pathway.

PTMs for TSTA3 Antibody (NBP1-83408)

Learn more about PTMs related to TSTA3 Antibody (NBP1-83408).

Blogs on TSTA3

There are no specific blogs for TSTA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TSTA3 Antibody and receive a gift card or discount.


Gene Symbol TSTA3