GALNTL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GALNTL2 Antibody [NBP1-81844] - Staining of human cell line ASC TERT1 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: GALNTL2 Antibody [NBP1-81844] - Staining of human stomach shows strong positivity in Parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALNTL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALNTL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GALNTL2 Protein (NBP1-81844PEP)
Publications
Read Publication using NBP1-81844.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALNTL2 Antibody

  • DKFZp686H1113
  • EC 2.4.1.41
  • GalNAc-T-like protein 2
  • GALNT13
  • GALNT15
  • GALNT7
  • PIH5
  • Polypeptide GalNAc transferase-like protein 2
  • polypeptide N-acetylgalactosaminyltransferase 13
  • polypeptide N-acetylgalactosaminyltransferase-like protein 2
  • pp-GaNTase-like protein 2
  • pregnancy-induced hypertension syndrome-related protein 5
  • Protein-UDP acetylgalactosaminyltransferase-like protein 2
  • UDP-GalNAc transferase T15
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 2
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 2

Background

GALNTL2 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of anN-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzymeactivity toward Muc1, Muc4.1, and EA2 than GALNT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-41312
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
DY417
Species: Mu
Applications: ELISA
AF7550
Species: Hu
Applications: KO, WB
G-125-C
Species: Hu
Applications:
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00004507-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88066
Species: Hu
Applications: IHC, IHC-P
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB274
Species: Hu
Applications: Neut
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
AF6590
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
DVC00
Species: Hu
Applications: ELISA
NBP1-81844
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GALNTL2 Antibody (NBP1-81844)(1)

Reviews for GALNTL2 Antibody (NBP1-81844) (0)

There are no reviews for GALNTL2 Antibody (NBP1-81844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GALNTL2 Antibody (NBP1-81844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALNTL2 Products

Bioinformatics Tool for GALNTL2 Antibody (NBP1-81844)

Discover related pathways, diseases and genes to GALNTL2 Antibody (NBP1-81844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNTL2 Antibody (NBP1-81844)

Discover more about diseases related to GALNTL2 Antibody (NBP1-81844).

Blogs on GALNTL2

There are no specific blogs for GALNTL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALNTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNTL2