Recombinant Human CLYBL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CLYBL Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 340 of Human CLYBL full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CLYBL

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLYBL Protein

  • citrate lyase beta like
  • EC 4.1
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-30951
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA

Publications for CLYBL Recombinant Protein (H00171425-P01) (0)

There are no publications for CLYBL Recombinant Protein (H00171425-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLYBL Recombinant Protein (H00171425-P01) (0)

There are no reviews for CLYBL Recombinant Protein (H00171425-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLYBL Recombinant Protein (H00171425-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLYBL Products

Bioinformatics Tool for CLYBL Recombinant Protein (H00171425-P01)

Discover related pathways, diseases and genes to CLYBL Recombinant Protein (H00171425-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLYBL Recombinant Protein (H00171425-P01)

Discover more about diseases related to CLYBL Recombinant Protein (H00171425-P01).

Blogs on CLYBL

There are no specific blogs for CLYBL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CLYBL Antibody
NBP1-84454

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLYBL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLYBL