CLPTM1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CLPTM1L Antibody [NBP1-84378] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLPTM1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLPTM1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLPTM1L Protein (NBP1-84378PEP)
Publications
Read Publication using
NBP1-84378 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24648346).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLPTM1L Antibody

  • cisplatin resistance related protein CRR9p
  • Cisplatin resistance-related protein 9
  • cleft lip and palate transmembrane protein 1-like protein
  • CLPTM1-like protein
  • CLPTM1-like
  • CRR9DKFZp761M2324
  • CRR9p
  • DKFZp666M1010
  • FLJ14400
  • FLJ32533

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Mk, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-P
H00057491-R01
Species: Hu
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82024
Species: Hu
Applications: IHC, IHC-P
NBP2-32114
Species: Hu, Mu
Applications: WB, IP
NBP1-86277
Species: Hu
Applications: IHC, IHC-P
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-59786
Species: Hu
Applications: WB
NBP1-69122
Species: Hu
Applications: WB
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NB100-556
Species: Hu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84378
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CLPTM1L Antibody (NBP1-84378)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CLPTM1L Antibody (NBP1-84378) (0)

There are no reviews for CLPTM1L Antibody (NBP1-84378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CLPTM1L Antibody (NBP1-84378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLPTM1L Products

Bioinformatics Tool for CLPTM1L Antibody (NBP1-84378)

Discover related pathways, diseases and genes to CLPTM1L Antibody (NBP1-84378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLPTM1L Antibody (NBP1-84378)

Discover more about diseases related to CLPTM1L Antibody (NBP1-84378).
 

Pathways for CLPTM1L Antibody (NBP1-84378)

View related products by pathway.

Blogs on CLPTM1L

There are no specific blogs for CLPTM1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLPTM1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLPTM1L