CLPTM1L Antibody - BSA Free

Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Analysis in human testis and skeletal muscle tissues. Corresponding CLPTM1L RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: CLPTM1L Antibody [NBP1-84378] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human tonsil shows strong cytoplasmic postivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human lung cancer, adenocarcinoma shows strong positivity.

Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human skeletal muscle shows no postivity in myocytes as expected.

Immunohistochemistry: CLPTM1L Antibody [NBP1-84378] - Representative Immunohistochemical staining according to Cleft Lip & Palate Transmembrane 1-Like (Clptm1L) & TMEM207 immunoreactivity at the invasion front of oral squamous cell carcinoma (OSCC). Weak Clptm1L or TMEM207 immunoreactivity was found in non-tumorous oral epithelial cells (A,B), respectively. In contrast, Clptm1L or TMEM207 immunoreactivity was found in many invasive OSCC cells. Representative positive Clptm1L immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (C,D), respectively. TMEM207 immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (E,F), respectively. Note the robust Clptm1L & TMEM207 immunoreactivity in (D,F). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35047994), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLPTM1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLPTM1L Antibody - BSA Free (NBP1-84378) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-CLPTM1L Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
• Predicted Species: Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLPTM1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: IHC, ICC/IF reported in scientific literature (PMID: 24648346). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLPTM1L Protein (NBP1-84378PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24648346).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CLPTM1L Antibody - BSA Free

• cisplatin resistance related protein CRR9p
• Cisplatin resistance-related protein 9
• cleft lip and palate transmembrane protein 1-like protein
• CLPTM1-like protein
• CLPTM1-like
• CRR9DKFZp761M2324
• CRR9p
• DKFZp666M1010
• FLJ14400
• FLJ32533

Background

Enhances cisplatin-mediated apoptosis, when overexpressed

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLPTM1L Antibody (NBP1-84378)(3)

Publications using NBP1-84378

• Hano K, Hatano K, Saigo C et al. Combination of Clptm1L and TMEM207 Expression as a Robust Prognostic Marker in Oral Squamous Cell Carcinoma Frontiers in Oral Health 2021-03-29 [PMID: 35047994] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Human)
• Inoue K, Hatano K, Hanamatsu Y et al. Pathobiological role of cleft palate transmembrane protein 1 family proteins in oral squamous cell carcinoma. J. Cancer Res. Clin. Oncol. 2019-01-11 [PMID: 30635792] (IF/IHC, Human)
• Jia J, Bosley AD, Thompson A et al. CLPTM1L promotes growth and enhances aneuploidy in pancreatic cancer cells. Cancer Res 2014-05-15 [PMID: 24648346] (ICC/IF, IF/IHC, Human)

Bioinformatics

• Gene Symbol: CLPTM1L