CLEC-2A Antibody

Images

 
Immunohistochemistry-Paraffin: CLEC2A Antibody [NBP2-14641] Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLEC-2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DDTRNWTASKIFCSLQKAELAQIDTQEDME
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLEC-2A Protein (NBP2-14641PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLEC-2A Antibody

  • CLEC2A C-type lectin domain family 2, member A
  • CLEC2A
  • CLEC-2A
  • KACL
  • PILAR
  • UNQ5792

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-77528
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB1900
Species: Hu
Applications: Flow, CyTOF-ready
9059-CL
Species: Hu
NBP2-25236
Species: Hu
Applications: WB, IHC, IHC-P
H00029121-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
NB600-1015
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF1718
Species: Hu, Mu, Rt
Applications: WB
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP1-76983
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready

Publications for CLEC-2A Antibody (NBP2-14641) (0)

There are no publications for CLEC-2A Antibody (NBP2-14641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC-2A Antibody (NBP2-14641) (0)

There are no reviews for CLEC-2A Antibody (NBP2-14641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLEC-2A Antibody (NBP2-14641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLEC-2A Products

Bioinformatics Tool for CLEC-2A Antibody (NBP2-14641)

Discover related pathways, diseases and genes to CLEC-2A Antibody (NBP2-14641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLEC-2A Antibody (NBP2-14641)

Discover more about diseases related to CLEC-2A Antibody (NBP2-14641).
 

Pathways for CLEC-2A Antibody (NBP2-14641)

View related products by pathway.

Blogs on CLEC-2A

There are no specific blogs for CLEC-2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLEC-2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC2A
Entrez