CLEC-2A Antibody


Immunohistochemistry-Paraffin: CLEC2A Antibody [NBP2-14641] Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CLEC-2A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DDTRNWTASKIFCSLQKAELAQIDTQEDME
Specificity of human CLEC-2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLEC-2A Protein (NBP2-14641PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CLEC-2A Antibody

  • CLEC2A C-type lectin domain family 2, member A
  • CLEC2A
  • CLEC-2A
  • KACL
  • UNQ5792


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, AgAct
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, Simple Western, ICC
Species: Mu
Applications: WB, Flow, CyTOF-ready

Publications for CLEC-2A Antibody (NBP2-14641) (0)

There are no publications for CLEC-2A Antibody (NBP2-14641).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC-2A Antibody (NBP2-14641) (0)

There are no reviews for CLEC-2A Antibody (NBP2-14641). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLEC-2A Antibody (NBP2-14641) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CLEC-2A Products

Bioinformatics Tool for CLEC-2A Antibody (NBP2-14641)

Discover related pathways, diseases and genes to CLEC-2A Antibody (NBP2-14641). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLEC-2A Antibody (NBP2-14641)

Discover more about diseases related to CLEC-2A Antibody (NBP2-14641).

Pathways for CLEC-2A Antibody (NBP2-14641)

View related products by pathway.

Blogs on CLEC-2A

There are no specific blogs for CLEC-2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CLEC-2A Antibody and receive a gift card or discount.


Gene Symbol CLEC2A