CLCN6 Antibody (2H2) - Azide and BSA Free Summary
                         
                                
                                
                                
            | Description | Quality control test: Antibody Reactive Against Recombinant Protein. | 
            | Immunogen | CLCN6 (NP_001277.1, 770 a.a. ~ 868 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQT | 
            | Specificity | CLCN6 - chloride channel 6 (2H2) | 
            | Isotype | IgG2b Kappa | 
            | Clonality | Monoclonal | 
            | Host | Mouse | 
            | Gene | CLCN6 | 
            | Purity | IgG purified | 
            | Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. | 
                                
                          Applications/Dilutions
                                
                                    
                                    
                                        
                              
                                  | Dilutions | ELISA Immunocytochemistry/ Immunofluorescence Western Blot 1:500
 | 
            | Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. | 
                                    
                                  Packaging, Storage & Formulations
            | Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | 
            | Buffer | In 1x PBS, pH 7.4 | 
            | Preservative | No Preservative | 
            | Purity | IgG purified | 
Notes
                    
                        This product is produced by and distributed for Abnova, a company based in Taiwan.
                     Alternate Names for CLCN6 Antibody (2H2) - Azide and BSA Free
                     Background
 
                    
                    The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB. [provided by RefSeq]
                      Limitations
 
                    
                    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are 
guaranteed for 1 year from date of receipt.
 Customers Who Viewed This Item Also Viewed...
                
                
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: WB
                                     
                             
                            
                                  
                                       
                                                Species: Hu
Applications: CyTOF-ready, ICFlow, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: IHC, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       Species: Mu, Rt
Applications: WB
                                     
                             
                            
                                  
                                       Species: Hu
Applications: ELISA, KD, S-ELISA, WB
                                     
                              
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P
                                     
                             
                            
                                  
                                       
                                                
                                                Species: Hu
Applications: IHC, IP, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
                                     
                             
                            
                                  
                                       
                                                Species: Hu
Applications: IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P, WB
                                     
                             
                            
                                  
                                       
                                                
                                                Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IM, KD, Simple Western, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
                                     
                              
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P, WB
                                     
                             
                            
                                  
                                       Species: Hu
Applications: WB
                                     
                              
                            
                                  
                                       
                                                
                                                Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: WB, ELISA, ICC/IF
                                     
                              
                   
                  
            
                        
                        Publications for CLCN6 Antibody (H00001185-M05) (0)
             
            
                        There are no publications for CLCN6 Antibody (H00001185-M05).
                        By submitting your publication information earn gift cards and discounts for future purchases.
             
            
                        
                        Reviews for CLCN6 Antibody (H00001185-M05) (0)	
                        
                        There are no reviews for CLCN6 Antibody (H00001185-M05).
                        By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount. 
                            
                                - Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
   
                  Product General Protocols
                        
                        Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
                        
Video Protocols
                        
                          FAQs for CLCN6 Antibody (H00001185-M05) (0)
                        
                             
                  | Secondary Antibodies |  | Isotype Controls | 
Additional CLCN6 Products
                            
                            | Research Areas for CLCN6 Antibody (H00001185-M05)Find related products by research area. | 
Blogs on CLCN6