CLCN4 Antibody

Images

 
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining in human cerebral cortex and pancreas tissues using anti-CLCN4 antibody. Corresponding CLCN4 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CLCN4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
Specificity
Specificity of human CLCN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLCN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLCN4 Protein (NBP1-84452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLCN4 Antibody

  • chloride channel 4
  • Chloride channel protein 4
  • Chloride transporter ClC-4
  • CLC4
  • ClC-4
  • ClC-4A
  • H(+)/Cl(-) exchange transporter 4
  • MGC163150

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69123
Species: Mu, Rt
Applications: WB
NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001181-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NBP1-91791
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
H00001185-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP2-60616
Species: Hu
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP1-80973
Species: Hu
Applications: WB, IHC, IHC-P, KD
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15437
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84452
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CLCN4 Antibody (NBP1-84452) (0)

There are no publications for CLCN4 Antibody (NBP1-84452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN4 Antibody (NBP1-84452) (0)

There are no reviews for CLCN4 Antibody (NBP1-84452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLCN4 Antibody (NBP1-84452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CLCN4 Products

Bioinformatics Tool for CLCN4 Antibody (NBP1-84452)

Discover related pathways, diseases and genes to CLCN4 Antibody (NBP1-84452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCN4 Antibody (NBP1-84452)

Discover more about diseases related to CLCN4 Antibody (NBP1-84452).
 

Pathways for CLCN4 Antibody (NBP1-84452)

View related products by pathway.

PTMs for CLCN4 Antibody (NBP1-84452)

Learn more about PTMs related to CLCN4 Antibody (NBP1-84452).

Blogs on CLCN4

There are no specific blogs for CLCN4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN4