Claudin-18 Antibody

Images

 
Western Blot: Claudin-18 Antibody [NBP1-60010] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, ...read more
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP1-60010] - Claudin-18 antibody used at 1:50 concentration in casein in PBS and left at 4C overnight on paraffin embedded canine bladder tissue. HIER was performed ...read more
Western Blot: Claudin-18 Antibody [NBP1-60010] - Tissue:Jurkat cells. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.
Western Blot: Claudin-18 Antibody [NBP1-60010] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, CaSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Claudin-18 Antibody Summary

Immunogen
Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the C terminal of CLDN18. Peptide sequence PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CLDN18 and was validated on Western Blot and immunohistochemistry-paraffin
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-60010 in the following applications:

Publications
Read Publications using
NBP1-60010 in the following applications:

Reactivity Notes

Canine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Claudin-18 Antibody

  • claudin 18
  • Claudin 18.2
  • Claudin18
  • Claudin-18
  • CLDN18
  • DKFZp564B2062
  • SFTA5
  • SFTPJ
  • surfactant associated 5
  • surfactant associated protein J
  • surfactant, pulmonary associated protein J

Background

CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
MAB4620
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP2-66784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82470
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1379
Species: Hu
Applications: IHC, WB
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-02259
Species: Hu, Mu, Po, Rt
Applications: Flow, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for Claudin-18 Antibody (NBP1-60010)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for Claudin-18 Antibody (NBP1-60010) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Canine.

Reviews using NBP1-60010:
Filter by Applications
Immunohistochemistry-Paraffin
(1)
All Applications
Filter by Species
Canine
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Claudin-18 NBP1-60010
Enlarge
4
reviewed by:
Hannah Wickham
Immunohistochemistry-Paraffin Canine 05/11/2022
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedAdult lung
SpeciesCanine
LotQC12109-43588

Comments

CommentsCLDN18 antibody used at 1:50 concentration in casein in PBS and left at 4C overnight on paraffin embedded canine bladder tissue. HIER was performed in Citrate buffer, pH6.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-18 Antibody (NBP1-60010). (Showing 1 - 1 of 1 FAQs).

  1. Our customer purchased NBP1-60010 for IHC. She tested as following way: Sample: human stoma cancer tissue, Dilution: 1:100 incubation, overnight used vector ABC kit. But, she got very weak stain result. So, she asked the positive tissue for this item. Could you let me know?
    • The Human Protein Atlas shows where tissues have stained positive using another company's antibodies for Claudin 18 (Protein Atlas). I would recommend a tissue that has been shown to stain positive from this list as a positive control. This protein is also highly expressed in the epithelial cells of the GI-tract.

Secondary Antibodies

 

Isotype Controls

Additional Claudin-18 Products

Bioinformatics Tool for Claudin-18 Antibody (NBP1-60010)

Discover related pathways, diseases and genes to Claudin-18 Antibody (NBP1-60010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-18 Antibody (NBP1-60010)

Discover more about diseases related to Claudin-18 Antibody (NBP1-60010).
 

Pathways for Claudin-18 Antibody (NBP1-60010)

View related products by pathway.

PTMs for Claudin-18 Antibody (NBP1-60010)

Learn more about PTMs related to Claudin-18 Antibody (NBP1-60010).
 

Research Areas for Claudin-18 Antibody (NBP1-60010)

Find related products by research area.

Blogs on Claudin-18

There are no specific blogs for Claudin-18, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Hannah Wickham
05/11/2022
Application: Immunohistochemistry-Paraffin
Species: Canine

Bioinformatics

Gene Symbol CLDN18
Uniprot