Clathrin Heavy Chain 1/CHC17 Antibody


Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human more
Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cell line U-251 MG shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Analysis of human cell line A-431 shows positivity in vesicles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Clathrin Heavy Chain 1/CHC17 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
Specificity of human Clathrin Heavy Chain 1/CHC17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Clathrin Heavy Chain 1/CHC17 Recombinant Protein Antigen (NBP2-49293PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Clathrin Heavy Chain 1/CHC17 Antibody

  • CHC
  • CHC17
  • Clathrin Heavy Chain 1
  • Clathrin heavy chain on chromosome 17
  • clathrin, heavy chain (Hc)
  • clathrin, heavy chain
  • clathrin, heavy polypeptide (Hc)
  • clathrin, heavy polypeptide-like 2
  • CLH17
  • CLH-17
  • CLTC
  • CLTCL2
  • Hc
  • KIAA0034


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC

Publications for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293) (0)

There are no publications for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293) (0)

There are no reviews for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293)

Discover related pathways, diseases and genes to Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293)

Discover more about diseases related to Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293).

Pathways for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293)

View related products by pathway.

PTMs for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293)

Learn more about PTMs related to Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293).

Research Areas for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293)

Find related products by research area.

Blogs on Clathrin Heavy Chain 1/CHC17

There are no specific blogs for Clathrin Heavy Chain 1/CHC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Clathrin Heavy Chain 1/CHC17 Antibody and receive a gift card or discount.


Gene Symbol CLTC