Claspin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Claspin Antibody [NBP2-55291] - Staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Claspin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VPKSLSSDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKESSHNSSFELIGSTIPSYQP
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLSPN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Claspin Recombinant Protein Antigen (NBP2-55291PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Claspin Antibody - BSA Free

• claspin homolog (Xenopus laevis)
• claspin homolog
• Claspin
• CLSPN
• hClaspin
• MGC131612
• MGC131613
• MGC131615

Background

Claspin is a cell cycle regulated protein. It plays a critical role in replication checkpoint control and interacts with the checkpoint proteins ATR and Rad9. It also associates with Chk1, but only following replication stress or other types of DNA damage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLSPN